SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70727636|ref|YP_254552.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70727636|ref|YP_254552.1|
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 3.01e-98
Family Homocysteine S-methyltransferase 0.00000518
Further Details:      
 
Domain Number 2 Region: 317-600
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-65
Family Methylenetetrahydrofolate reductase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70727636|ref|YP_254552.1|
Sequence length 612
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein [Staphylococcus haemolyticus JCSC1435]
Sequence
MSRLLNQLQNNVLVADGAMGTILYSEGLDTCPEAYNLTHPEKVESIHRSYIEAGADIIQT
NTYGANFEKLRRFGLEHKVKDIHKAAVAIAKRAARPDTFILGTVGGFRSLQQEELPLSTI
QYHAENQIDTLVEEGVDGLLFETYYDLEELTNIVTTTRRKYDIPIIAQLTASNTNYLVDG
TEINKALQQLVACGANVVGLNCHHGPHHMQRSFSHIELPETAYLSCYPNASLLDIENSEF
KYSDNAQYFGDVAQELINEGVRLIGGCCGTTPQHIAYIKSSVKDLKPVKNKNVIPINRQT
NRAVTHTYKHNLTTKVKNGPTVIVELDTPKHLDTDLFFENIGKLDEANIDAVTLADNSLA
TVRVSNIAAASIIRQRYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSKV
GHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKHTNFNIAGAFDPNVRKLDGAVKR
LEKKVAAGMNYFITQPVYSKEKIKEVYEATKHLNVPLFIGIMPIASYNNALFLHNEVPGI
KMSEDVLSQFKAVKDDKEKTKALSLRLSKELIDTVHEYFNGLYIITPFQRIDYSLELAAY
SKAITQNKEAIS
Download sequence
Identical sequences A0A028Z408 A0A1F2L6H5 A0A1J4HEA9 A0A1N4XGL9 Q4L331
WP_011276876.1.100919 WP_011276876.1.10109 WP_011276876.1.101253 WP_011276876.1.101333 WP_011276876.1.101994 WP_011276876.1.1027 WP_011276876.1.10422 WP_011276876.1.11818 WP_011276876.1.1225 WP_011276876.1.12511 WP_011276876.1.12694 WP_011276876.1.12910 WP_011276876.1.13054 WP_011276876.1.1311 WP_011276876.1.1380 WP_011276876.1.14283 WP_011276876.1.14470 WP_011276876.1.14598 WP_011276876.1.15116 WP_011276876.1.15895 WP_011276876.1.16163 WP_011276876.1.16219 WP_011276876.1.16495 WP_011276876.1.18129 WP_011276876.1.18323 WP_011276876.1.18844 WP_011276876.1.19491 WP_011276876.1.1978 WP_011276876.1.20173 WP_011276876.1.20249 WP_011276876.1.20471 WP_011276876.1.20834 WP_011276876.1.20864 WP_011276876.1.21698 WP_011276876.1.23003 WP_011276876.1.2357 WP_011276876.1.23919 WP_011276876.1.26373 WP_011276876.1.28455 WP_011276876.1.28860 WP_011276876.1.29037 WP_011276876.1.297 WP_011276876.1.30324 WP_011276876.1.31288 WP_011276876.1.31494 WP_011276876.1.35706 WP_011276876.1.3637 WP_011276876.1.36410 WP_011276876.1.36612 WP_011276876.1.36913 WP_011276876.1.37394 WP_011276876.1.37871 WP_011276876.1.39200 WP_011276876.1.40163 WP_011276876.1.402 WP_011276876.1.4220 WP_011276876.1.43577 WP_011276876.1.43780 WP_011276876.1.44205 WP_011276876.1.44226 WP_011276876.1.44543 WP_011276876.1.4581 WP_011276876.1.46811 WP_011276876.1.48297 WP_011276876.1.48683 WP_011276876.1.49011 WP_011276876.1.49079 WP_011276876.1.49716 WP_011276876.1.510 WP_011276876.1.51540 WP_011276876.1.51872 WP_011276876.1.51997 WP_011276876.1.52664 WP_011276876.1.53148 WP_011276876.1.53191 WP_011276876.1.53313 WP_011276876.1.54595 WP_011276876.1.55678 WP_011276876.1.5596 WP_011276876.1.58879 WP_011276876.1.589 WP_011276876.1.58915 WP_011276876.1.59500 WP_011276876.1.60041 WP_011276876.1.61337 WP_011276876.1.61390 WP_011276876.1.63295 WP_011276876.1.63323 WP_011276876.1.63725 WP_011276876.1.64661 WP_011276876.1.64835 WP_011276876.1.64863 WP_011276876.1.65907 WP_011276876.1.65972 WP_011276876.1.66148 WP_011276876.1.66202 WP_011276876.1.66793 WP_011276876.1.66833 WP_011276876.1.67078 WP_011276876.1.67111 WP_011276876.1.67157 WP_011276876.1.67271 WP_011276876.1.67478 WP_011276876.1.67846 WP_011276876.1.68076 WP_011276876.1.68328 WP_011276876.1.69277 WP_011276876.1.69544 WP_011276876.1.7082 WP_011276876.1.70824 WP_011276876.1.71127 WP_011276876.1.7114 WP_011276876.1.73426 WP_011276876.1.74301 WP_011276876.1.74601 WP_011276876.1.74627 WP_011276876.1.74640 WP_011276876.1.75368 WP_011276876.1.76617 WP_011276876.1.76890 WP_011276876.1.76990 WP_011276876.1.77553 WP_011276876.1.77591 WP_011276876.1.78694 WP_011276876.1.79350 WP_011276876.1.81188 WP_011276876.1.8193 WP_011276876.1.81983 WP_011276876.1.82332 WP_011276876.1.82878 WP_011276876.1.83289 WP_011276876.1.83870 WP_011276876.1.84269 WP_011276876.1.84838 WP_011276876.1.85768 WP_011276876.1.87015 WP_011276876.1.8732 WP_011276876.1.87507 WP_011276876.1.88266 WP_011276876.1.88267 WP_011276876.1.8871 WP_011276876.1.89180 WP_011276876.1.8934 WP_011276876.1.90039 WP_011276876.1.90558 WP_011276876.1.91141 WP_011276876.1.92000 WP_011276876.1.92193 WP_011276876.1.92210 WP_011276876.1.92713 WP_011276876.1.9312 WP_011276876.1.93353 WP_011276876.1.93901 WP_011276876.1.96210 WP_011276876.1.98145 WP_011276876.1.98869 279808.SH2637 gi|70727636|ref|YP_254552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]