SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407720550|ref|YP_006840212.1| from Sinorhizobium meliloti Rm41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407720550|ref|YP_006840212.1|
Domain Number 1 Region: 92-187
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000183
Family Barwin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407720550|ref|YP_006840212.1|
Sequence length 346
Comment rare lipoprotein A [Sinorhizobium meliloti Rm41]
Sequence
MTSNNGAAYLVRGLRLAAVPLLCAVLAACGSTSSVKKTKSRSKEYFAESVYGVKASPRVA
TGNNIPKGGGRYQVGKPYQVKGRWYQPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDKH
HLSAAHPTFPLPSYARVTNLENGTSVIVRVNDRGPYEYGRIIDVSSKTADLLDIKRKGSA
NVRVQYVGRAPLEGNDMPYLMASYVRKGDRGPSVMPEGQIASGVMVASNEPLRDMVPNLR
AVPVPNKSMLDAGVPVNALAKPAQAPAATSAFGEFVVLPQIGPMPTSRPQLIPLPDGSMA
YAAAYVEVRVSDKPSPFEAIMVDRNPLTPDSILAYAKRQHRNADSR
Download sequence
Identical sequences A0A0E0UCL5 A0A222HIW2 H0FY53
gi|433613385|ref|YP_007190183.1| WP_003528312.1.18618 WP_003528312.1.22199 WP_003528312.1.24285 WP_003528312.1.3038 WP_003528312.1.3110 WP_003528312.1.32135 WP_003528312.1.34728 WP_003528312.1.36091 WP_003528312.1.36292 WP_003528312.1.36834 WP_003528312.1.44594 WP_003528312.1.47143 WP_003528312.1.55094 WP_003528312.1.58221 WP_003528312.1.58608 WP_003528312.1.63001 WP_003528312.1.65778 WP_003528312.1.72343 WP_003528312.1.73540 WP_003528312.1.79107 WP_003528312.1.83096 WP_003528312.1.83536 WP_003528312.1.89614 WP_003528312.1.90561 WP_003528312.1.90968 WP_003528312.1.92524 WP_003528312.1.94084 WP_003528312.1.96031 gi|407720550|ref|YP_006840212.1| gi|334316241|ref|YP_004548860.1| gi|384529358|ref|YP_005713446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]