SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPPG_01997T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_01997T0
Domain Number 1 Region: 979-1096
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-22
Family cAMP-binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 780-893
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPPG_01997T0
Sequence length 1117
Comment | SPPG_01997 | Spizellomyces punctatus DAOM BR117 sulfate transporter (1118 aa)
Sequence
MTDPGEIHSKRQGHSRSSSSSSGSSSNSSASARGGTPASLPIPTPTIPTPTQAEHPITAR
LRRTGSGRGRTQIARSYYSTRSDESCYSIDEPSLTLSAAQVRQQTLSWTYRELKLGSTPL
EAARRRSTRPPFPNVLREGPSAPEDSTSDATGGAGQASSADPRAGKDMFDSLLQQKTEGF
ARKRQVSQLSALRQLALSIEQQTAADDAEDNVETSTEQTPLLAAKSARPVEDTEMPDVSR
PFRAAIQVEEGFAKPNGVRGTFGNDDVWEDRASAEVMDEAYSSGRKSYGGQCWDNCFHEM
VRSLKQFEMRDLLTWSGWIMAALPAVVLALILNLLDAMSYGIIIFPSSDEHMPDTAIQAG
ISMFLTSTLISQLVYTLGGSAFKGAVGSMMIEVMPFLHIMCRTVEEHMNGADSKAILATI
MVAYAMSTLMTGIVFFLLGAFKLGNLIQFFPRHILVGCIGGIGLFLILTGIEVTTGIPNE
YSLEWIRNIFTPSALMLWGSSLGLAVCLKIMQRRIHHPLFVPMFYVAVPVVFFIIVLVAR
IPMDELRRSGWLFPMPEGEPAPFYEFWTYYDFGKVDWTALPATIPTQLALTFFGILHVPI
NVPALAVSTHQDVDLNRELIGHGISNFVSGLFGATQNYLVYSNSILYIRSGGASITGGLL
LALGTALVWIAGGKVVAFVPTIVVGALIFHLGIDLLKESVVDTWNTGIHTLEYLTILSIV
TIMGVVGFTEGIVAGVILACTFFVVMYARKSVIRAVYTGSQLRSTVHRLYRQQCFLDQVG
DQIHCIKLQGFMFFGTINQLDVYMQNVLNENPRIRYIVLDFSLIYGIDYSALESFHRIKR
MLRERNTGLVFAGLATVGRTLAQSGIFEHEEEQDALNVHNFGNLNEALEWCENQLLVTYY
VKQASRSSSAASLEIPRHTVPPALNDSGSVFGISHLTPRQQEVHKAASKILKEDPLPPRP
EREGFLPVAILLQAFSENAEYDAELLHFCEGRFQRVTVAKGTILWFPGEEAKDLYVIEEG
ELALLIVEHHRSGQQMKVVETLLPGTMVGELEMFTSRPRTCRLVANDDSVLWRLSKETFE
RMSEENPQLMLKFVTKIALSFDAVRFYNTVYHWGQLK
Download sequence
Identical sequences A0A0L0HNB6
XP_016610955.1.7107 SPPG_01997T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]