SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPPG_04976T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_04976T0
Domain Number 1 Region: 502-530,611-669
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPPG_04976T0
Sequence length 752
Comment | SPPG_04976 | Spizellomyces punctatus DAOM BR117 conserved hypothetical protein (753 aa)
Sequence
MTYKASGPTKVQSRYPTQYQQFAQKAKNGLRHVPEYSVDYVRGLFPIASWLPRYNRDWLY
GDLIAGLTVGIVVIPQALAYAKLATLPLQYGLYTSFTGVLIYALFATSKDVTIGATAVLS
QLTGQVLATYNADKSMDPVTFAIAVSFLTGLIQLALGLFRLGIIVDFIPAPVIAGFTTGA
GIGIIIGQFAGLLGIKGINTNDPAYQVLGNTLKALGQTQLDAAFGFAGLVSLLLFKFGCR
YAVKRGYPFMKWVSLSRNAVVIIIFTAISYAINHQNRKSPRIRIVGDIPKGFGPIHVPDV
SDLSKVAPASVTVVIVAILEHIAVVKSYGRLNGYRPDANQELVALGFTNFLGSFLGAYPA
TGSFSRSAIKSQSGVRSPLAALFTAAIVVLALYVLTPLFYYIPSAILSAIIISAISDLIS
RPALVKQLWDIQFLDLFAFLLALVFTFFFSIETGIYVSVGFAVAVLLYRLARPHYQVLAR
SNDTGIWVNVKDAQLGHTASPPPPGVLVFKLEESLTYPNANYFAEHIKEIMIESTEFGGP
ILKSNQKLWCDDTDDKIKRARKALAKKKAVSEQEIVPDIRLEIRDNDNSPSVTPPRKESV
DSGSHSDETLTSLPRLRAVVFDFSAVNGIDSTGVQTLVDLRRDMDAFAGQRVEIHFAHVR
PRFERILEYFLAITRTDRDVTPVVPTDIPIEETATNSNPPSSTDKNLVPFVDVRELFHAT
VDLAVAAIERRRSRASSFEKKQPEIDEIKVHS
Download sequence
Identical sequences A0A0L0HFP0
XP_016607628.1.7107 SPPG_04976T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]