SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_06619T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_06619T0
Domain Number 1 Region: 23-71
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000902
Family Transducin (heterotrimeric G protein), gamma chain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPPG_06619T0
Sequence length 107
Comment | SPPG_06619 | Spizellomyces punctatus DAOM BR117 predicted protein (108 aa)
Sequence
MFTLPHMLPPPKTPPPKTPTPVEQESRLVRLEKYLEKLQEQLALESVPVSEASSSLVKCS
QSMLLHDPLIPSSYVEKIYPDEERPPNIYKDRSANLKRMCVQSCRVL
Download sequence
Identical sequences A0A0L0HBH9
SPPG_06619T0 XP_016606259.1.7107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]