SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPPG_08184T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_08184T0
Domain Number 1 Region: 589-619,658-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPPG_08184T0
Sequence length 892
Comment | SPPG_08184 | Spizellomyces punctatus DAOM BR117 RNA recognition domain-containing protein-containing protein (893 aa)
Sequence
MPAFHKNSLSPFASAEQDQGLNNDNIGPVSESTPLLDTSVDGFESTDNDKLFGSPVELRR
RDGCKGQFSSPETGVWLTPSTYSYSAYYKAFQTRLRYYVPVIGWLPKYNFRRNLQSDLIA
GITVAFLLVPQGLSYAQALVKIPPIHGLFTASIPLLVYGFLGTSRQLSLGPEALISILVG
ATIKEYSASKEPRHGSIPSLGAADPQQEAVEIALVLCLMVGILTFLLGFFRLGFLDSVLS
RALLRGFVLAVAMVVMIDMADTLLGISPPSNQCGHGPSKPVDPAPDGESPIQKLFDTLSK
LGQAHPLTTILSASSISFLIGMKVLKAKFGKKRWLQVIPEILVLVVVTTILCQVFRWDCQ
GVAILNVKGSDSAEYRYPKLPTMTLSRIRALMLSAILISVIGFVESIVVAKTYATKHNYS
VSPNRELVAIGVSNIVGSILGAYPAFGSLGRSAVNDTAGAKTQMAGFFTGIVVLCTTIWL
LPFFQFLPKAVCSSIIVVAALKLVELEDVHFMLRLRAWKDVGLMMITFLTTILLSIESGT
LLSVGISLLLVIKHTTKTRLAILGHILVVDPRTGNVKTKYRSIHDSDKVQRIEDALVVRV
EEGLFFGNSGQLKDRLKRIEMYGDLGVHPGEEPRRIPATRRRSQSRPEEQAMEEGHSPAD
DHIRAVVFDFGAVTAIDASATLTLLEIVEDYKHRNMEVCFVKLRESCKHAFLRSGLYDLV
GPSHFFRKVRDATEYLKSTDRRRMPQDPNQPESMAPRDIVIPGNGQGASSQQHAQEWTVP
NKKGSFAASSYFASYMEDAELERRSGVIIRGEPQSEVEEDIFVTGSDNAGSHTGFAKRFR
ARSGKIPLGLATLFDERNSVELTTDSEVESPGFGPDAEDTVRSGRVPTDGHV
Download sequence
Identical sequences SPPG_08184T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]