SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PB13879-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PB13879-RA
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily LysM domain 0.0262
Family LysM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PB13879-RA
Sequence length 82
Comment protein AED:1 QI:0|0|0|0|0|0|3|0|82
Sequence
MIIVLMIYYKESKDTLYDVLRTLGRNLFSIDASNRHGNKTIIKADQIKIINKENQTIMVD
TRVVLLEHETQYAGNDMQPLSV
Download sequence
Identical sequences PB13879-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]