SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB17593-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB17593-RA
Domain Number 1 Region: 984-1158
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.83e-39
Family BRCA2 helical domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 1500-1636
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-33
Family Single strand DNA-binding domain, SSB 0.0023
Further Details:      
 
Domain Number 3 Region: 1161-1287
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.08e-33
Family Single strand DNA-binding domain, SSB 0.00014
Further Details:      
 
Domain Number 4 Region: 1291-1320,1425-1494
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-20
Family Single strand DNA-binding domain, SSB 0.0083
Further Details:      
 
Weak hits

Sequence:  PB17593-RA
Domain Number - Region: 1321-1359
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0536
Family BRCA2 tower domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB17593-RA
Sequence length 1759
Comment protein AED:1 QI:0|0|0|0|0|0|10|0|1759
Sequence
MSDAMRAERGAIMEPSTIDSAEEESDELFSVIFCSSSLNYKGLLLSLIFQTEETPKLEQH
TPDVLDKIISDSPVIARATRRRSKRRIFRSSISIDSSAVTNNEDITVEVETPAISNNTNF
ASRDDIAHVAKSDPSVENVFKDHKLQVPNKGQDTCNNENSENFNPVPDSSNTSTQEFFND
VSFSKIDELCFDAFDDRRATETFVTSCNYKWNIEGMDKGINVEENKSIGFFTGHGASINV
SKQALFKAKRLFAEAFDTDEIQTRNYEPFAKRNKQINRHLPSSSFVNISSNTREEALSKP
KPSREQPKNYDVTDCKKLFTNETFSEEASKVPVFLSTASGNPINISKEALLKAKTLLADE
SDNVDDDVFKKFYERSDNNSMTIKNVAVPSFPATNIRPIATSGKSKTLFAEQLNAAIEST
SNKTDNEQCDINISNIRQSINFEPLPKSKTLFAERNDSLESTLRKEMYNSDNEIKRQEVN
VSKIGFQTACNKPINISEQALSKAKALFAKLDDTYKAPVTKEIDNKMMGSETKISNIRLQ
SISSTDISEQISKVKESFEQLNTSLESVVNRANVNDKEENRQEAKISPRIRFQTAGGKSI
NISEQALSKAKTLFAKLDDKAPVVKEVDNKIKSSETKVSNMKLQCISSSEISEQISKVKE
SFEQLDTSLASAANRASVDDKVENGREAKVPSIGFQTARGTSIGVSKQALSRTKALLADL
LDGPLEMDIPESTGRDEGIQKRDLVIPYGGLQTASGRQVPVSSNAALIARELLTDDCPDE
SNPGLARASLQKRELSETNADESTPQGRNRLSEMKKVRLSDEFHARRLFADNPCVDEARG
PDEKEPVPFVADSVLGSPKSDAVESTESDAVGSPVIGRQPVSRKRKSSGHQRREARADKR
ILDKEDVTSRENIVRKAVSRGELEDDKPDTGTRKLAQVPEGRIKDDNVESREYGDTQVMM
DFIDESTKILQDRLAAALDQEAIITAKRRHGSKRSVGHLYRYKQINFNARLSLREISGGT
LPLPRSYRELVDRRIPPDVLEITAATAASYRFRCSDFYGNDVAYGNVGGIEMEDGARLIL
DENGDTGVWEFLRAFLAAPGVDPNLVPARWVENHYRWIVWKLASMDRMKFSEIELPRMLT
PSRVMAQLKYRYDREIDRFQRPAIRRILEKDDVPSRRMILCVSSVVENNNVSMEVGKSPR
VGVPKWRIELTDGWYSINACIDIGMVRSISTGKVKEGTKLAMSGAELLNCDQGFHPLEVP
ADVYLKLHTNSTRRARWDTKLGYTPCSGPIPIKLRNVCPSGGLIGKVTVVVARVYPMLYH
EKTASGDSIVRNAKSEEKAQGKYEQQCWSKIEAFYANAEDFRRKGLSCETDDMAIQLSED
YENLSEESISKKRRDELLQELHEKEERFKQRMQSKLRESLPGPRQVSQLLKVRVCDENAN
AILSVWSPSEEVVDALKEGACVSLCNVVASGKRGTELQLTANRSAIFQPGKMRDASYPAR
ACTPLCEITNSEFAPPYGEFDTVGLVCSVGPAPYGMKDFEAVHLASNDSSYLSILFWQGI
AGYGYAEILTVGSIVACSNLEWRRATSWNVPAAYCTERSIFTRNPRRNHLYESFENLRNL
ITDPIKYVESCTFELNVELQKKSTPTRFVASKSTPIKIYNSMSNADKKLVDYTSPLAIPK
LGVVDSSNYPAANLSIQKRLEKLQHYEEPPELSPIILKKSKRISLDFRSPVCISDVNLTK
ETLSINHQSSDSNIPITEL
Download sequence
Identical sequences PB17593-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]