SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB24679-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB24679-RA
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily CutC-like 1.44e-64
Family CutC-like 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PB24679-RA
Sequence length 201
Comment protein AED:1 QI:0|-1|0|0|-1|0|1|0|201
Sequence
MEICIDSLESARNAVEGGASRLEVCSALSEGGLTPSVGLIQQIRNFTTIPLFAMIRIRDG
DFVYSQEEIDAMLYDLKILKDHHVNGFVFGALTPDCEIDTVACEKIVFAAHPLPVTFHRA
FDLTTDPIKSMKLLTELGFQRILTSGQKNTALEGLELIKTLLQKDLKLIIMPGAGITKDN
IREIMASGAKEFHASAKKEKW
Download sequence
Identical sequences PB24679-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]