SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB25974-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB25974-RA
Domain Number 1 Region: 347-474
Classification Level Classification E-value
Superfamily Plus3-like 3.53e-45
Family Plus3 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB25974-RA
Sequence length 697
Comment protein AED:1 QI:0|0|0|0|0|0|7|0|697
Sequence
MPKRKHQALIDSDSSGSASESGSDLDNDLLSLAKKKKGKSQDDSQSNEDNGSVKKDIKHD
SDLSDSDDNWNNKTGKPKKKKAPAKRSKRKMTKSSSEDSASEKEPAKQLSEPEEGEVSDS
DPSVSSSSQEEFNDGYDDKLMGDAEDQARLAQMTEKEREQEIFKRIEQREIMKTRFEIEK
KLRMAKKQELKKQKESKKKEKGVEEKQKIDRAPDPKERSKDRKKTIEEKQDKKFHAMSLL
KARREEKKEREEKEKQRIEQQQQQTKDIEEEELDDDHKGGTNKTKLKASDIYSDDSGSSD
SAEEEEVAKPASRRSSSSESRDSDSDNDKKSITSNKARPKKPVYISTKEDLNKIRLSRHK
MERFVHLPFFDRVVQGCFVRIGIGNNNGKPVYRVAEISGVCETGKIYQLGGTRTNKGLKL
RHGAQERVFRLEFVSNQEFTDSEFFKWKETCALQGISMPTFDEVEQKLKDIKEALVYEFK
EEDIEKIVREKERFKQTPYNYAMKKAQLMRERDAANCRGDDETASRLNQELSELEERASE
LDKMRTATISSISYINDRNRKKNVEEAEKAIMEEFKANKGKKVDDPFTRRSTKPRMVYKP
EDESEVVTTVSVNDKSSPHLAGDSMSAADKENGQESKKKQSTEDLFNAHDFDITIDLEVP
LPSNPVSVVPKPINNIKDTGPRRSLNLEDYKKKRGLI
Download sequence
Identical sequences XP_011646343.1.19355 PB25974-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]