SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB14591-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB14591-RA
Domain Number 1 Region: 19-309
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000000129
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PB14591-RA
Sequence length 325
Comment protein AED:1 QI:0|0|0|0|0|0|3|0|325
Sequence
MISLFFFSPAAHLTVDEPWEHGPEYTFQVQVNCTAIPEEGVYGSVRLNLVSKLICQPKDG
HTLSCHFEDSTANSFVVDSLDPSEPVAPVGPVNRQPAYEINEDQFEIKFNKRGLDSLVVN
ENIQPRELDMIRMIVGQLSIGATLEGIGNDLTFDTMENFTQGECFTTFKIDKKLVGRSLY
AKPGYTLRPVFGLKDGKLVQIRKIRNLHMCAHKVPYLFGSAESFREESDIMSDIVSTFLL
LLNFDLSLSDGHIIITSTEFISGTSNVITTSKVTEAVITTLYENVRLRLESIQAAESEPP
TVKEAEPASIFIGRWLIDDSSEEDN
Download sequence
Identical sequences PB14591-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]