SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB18510-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB18510-RA
Domain Number 1 Region: 1274-1489
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000654
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 1450-1661
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000216
Family Tropomyosin 0.0045
Further Details:      
 
Weak hits

Sequence:  PB18510-RA
Domain Number - Region: 988-1221
Classification Level Classification E-value
Superfamily Tropomyosin 0.000222
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number - Region: 310-529
Classification Level Classification E-value
Superfamily Tropomyosin 0.00915
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PB18510-RA
Sequence length 1801
Comment protein AED:1 QI:0|0|0|0|0|0|24|0|1801
Sequence
MAETIPCDTSKPATATVSSTTVLEAAHQTLRDVREEQIHDLDTALKKLGEERRKCEELLQ
LNASLKDQLEESHQTNEALTNDLQKLSNDWDILREELAIKEDEWKEEEQAFNEYYISEHN
RLLNLWRDVVSVKRLFAEMKSTTERDLSKLRNEIISSSNEMTSACNSANFTMKLQATATT
QSTRMQQQEEAQAVTVLKTEITALKQQQAANQHEIRTKDDRIDQLIREIRNLEERCGVSE
AAVAQTARMQEDIEVLESALRDIAHAVIQDAESRDADAKQTPSHIHVSSSGPNPQRSPKR
SARSNIPALAESTISAVRAALQKYQLTIRELQIKSQTNKEQILMMRKQCDTAEENAQALN
ARVAELISQLDACRSQCTQLGQEKEMLQKSLDNVKLEKNALDKNKVELNSTMEALKNNYE
KLQKTVNKLQKLCDNLEDEKLYLQNELSRASEDVDLKELSLRSEEDRCSKMREEILTLRE
DLSKAYLAKDMLEQQKLETDGLISQIEKSKGDLELELERILLEKSDIQEILMKMEAICSN
HEQDKQRLQEELKKMADEKNKLASQCIDQQGDLNSLRKELLQAEQTRLDCESEKVTLNEK
IKFLEIEKEKVEMELGQITRERSDLSNQLSVLARKKETLNEELMRLRQRLEQSNEMNARI
NRNLKDLVLLETNEKEFQRLQEQLASMRTEKEILEGVLFDTQTNLEATHIKKTQLEKEQK
EMLIKQESLKGQITRLTKELENSEKRAQDIKQSLTQQSGDQVAEFQQVISNMKRQSEDSI
KKINDEKEQIRISLEKRLQQSLLQMEGEKNEEISQLQLRIEELQQHIENLCKQHEEALLR
AENDKQQALLIAHHDQQALIEKIDAIMRELEEEKNTLERVKREAAARAEQERNNTNQLRD
ELNRLRTKLDETKLRANEEKMKLDLKIEELWKERESAQREVEELQVQLHMMEDKVDGLQN
QLHDTIRKLKDADNVNETMRKELVDVRRQLADTTYEKEKYNNSNKELREHVKQIESERRE
QGRTLEESYQKIATLEDAKASMDVERTRLQAQIRDMERDAMQLQQQLRFTQDELQKCHEN
NAQAQNEEKELQARLANETEERERLQLQLHQVKKQVVDLDNSLEVTRQELGKLRARADEE
DERWRAREQELLVRLEDSRCRERKLEDQKHNLEVCLADATQQLQELKARLGGSEGRVRAL
DAQLSQLETAKKEVEQKLSSVGSTLRRIAGIQMDGSVNMPFKLMSPSRRWSPARAQDHGD
RDIILDVDPEAVRKGVRSLMQQVAQIERERDDYKTELCSFKKQLKESQESQSNTDAKVNN
LLANIRTLQEEKKSMEAKLIQAQTGYQAQLDALQQKTKECEQLCEKLTTLEIKMTTESDE
KSQYEDKLEKMKQELNRLETEKRNLQKEKLQDRFDTQSRTMAGLEERCASLKSTIEQLKL
ALEKASATESELKSEINLLQHNMIQITASSQSTNEKFKQLQKQLSNTENDRRILSERLEM
AQQTLNNLKHTNQSLIDQNARLQNELANNEVQRSALESQLRLSTWPPEGSATKDEELLRQ
LQTAQRERSELRGKVDALNDKVKLLEADKRNLERQITSSKTVSTRSKSYERPEKAHIELL
GTSYSLDHLEHENRELRLKIRKLETQLAEKEAELIRMKSTYIHSSHSLLDTSRDRSELER
IRAAQLQAEKLLEAREQSHRQQVSRLENQIQLLREQLNQEIKRRQLYVLRSSRAGREMQQ
LRQALGDSLKTVSQDPSLDAVLLEHEARKLDSTLTSTASLPPSLALPAPPSYRSNTPSQL
K
Download sequence
Identical sequences PB18510-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]