SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PB22866-RA from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PB22866-RA
Domain Number 1 Region: 412-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PB22866-RA
Sequence length 620
Comment protein AED:1 QI:256|0|0|0|0|0|14|431|620
Sequence
MSTAAPELTVRRPVYQQDELNHLCKYVKPKRIFSNEVSKRCKSIKPITFLKKSIPLIDWL
SSYDWKNNILGDVVAGITVAVMHIPQGTLRMAYAILGNVPPIVGIYMAFFPVLVYFFLVH
PDIIPWTYVDVFNSLNNINTTAVILSCITILALIFNNEVLKPRVSKLCPFPIPIEMLVVV
IGTVISMQMDLADTYNVITVGVIPVGLPVPSAPPLSLIPNILVDSIVITMVAYTISMSMA
LIFAQKEGYEIDSNQELVAQGLGNLVGSFFSCMPITASLSRSLIQQTVGGHTQLASLISC
GILVSVLLWIGPFFQPLPRCVLASIIVVALKGMLMKVTEFVKFWRLDKIDAGIWAVTFIV
VILFDVEYGLLVGILLCIGRLLVLAMRPYTCKLALAPGTELYLDAKRYKGTVEIPGIRIF
HYSGSLNFASRQYFREEVYKVAGIVPQKELNRRQKAACNGTVAEEIKKLRILILDFSALS
HIDLAGANALRNIVDEYCAIQVSMYIAGCSGPVYETMRKFNLTEYNENHFFAMFPTVADA
DYDGQARAEKLSRVIITLFGVVGLIWGYAIQQFSQTIYILGAGFVMAALITVPPWPMYRR
KPLDWQKPQSEVITKLKKKK
Download sequence
Identical sequences PB22866-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]