SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pbar_Yp1-1 from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pbar_Yp1-1
Domain Number 1 Region: 392-744
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.02e-59
Family Lipovitellin-phosvitin complex, superhelical domain 0.00062
Further Details:      
 
Domain Number 2 Region: 2098-2473
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 9.29e-59
Family Lipovitellin-phosvitin complex, superhelical domain 0.00074
Further Details:      
 
Domain Number 3 Region: 1723-2021
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.06e-52
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0086
Further Details:      
 
Domain Number 4 Region: 23-327
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-50
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.011
Further Details:      
 
Domain Number 5 Region: 765-1034
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.18e-16
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.047
Further Details:      
 
Domain Number 6 Region: 2477-2775
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000000133
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pbar_Yp1-1
Sequence length 3356
Comment protein AED:1 QI:40|0|0|0|0|0|13|0|3356
Sequence
MWLPFTLLILAGVAAAKPDHDCAWNSQTEYRYLVYSRTVAAIGQIKGQYTGLQVRGTLVV
QAPSTNTLRARLENPQYANLHAPLRNGPESEIRDEVLQYRDLPMSGKPFEIKLKHGLIQN
VLMDNDVPIWEVNMIKAIISQLQVDTKGENLIDSKGTQIPDESQPFGTFKVMEDSVGGKC
EVLYDVSPLPDNIGLMRPDKVPMPEERGDDGHFYEVKKTKNYKKCQQRQVYIYGLNDPTK
VSQLDRQDDVVSELSSSEVVISGHLREYTIQSSVTRNQIYVKPRRTEGVLGTVHCIMKLT
LAKKSPITTELRLSDNLMSTGNLVYTFNSPFYDFGNRRPFVDKRHRRIQKVISSQSSSSE
SSSSSQSNEKDIDDTILQPLTDLRLPPNIPLLPFFVGFGGNNVQTSEEVNMESVMKIIME
ISNEIQQPERIQDNQTLEKFTILKNILRTMSYKQYSELNNRIPHKKLSNKHSDTWNIYRD
AVAHAGTGPALLTITDWIKNKKIENLEAAQVLAQIPKHVRTPTAEYIKTVFELIKHPVVA
QQKHVSSSAIVAFAELLRNVNGGHYPKRTFGPLISEDNKDVEEIYIPYMANQLKHAISRS
DSPRIQSYIVALGVTSHPKIISVLEPYLEGTQPASKFQRMLMVSSLTTLIQTQPKLVGPI
LYKIYMNTREAHELRCIAVHNFIKSDPPMLMLQRVAKFTNYETNEHVNSVVKTTLESLAN
TKRPGWEKLARKVRIALRQINPKIATTWNSMGYYRYINSWIINGFSMQTVVSEDSYLPSF
VHCALNTIFDRYSQPSLEEKYAVSSVKQLLNHLQNQGTSQSSSRRTRVDKLVKTLKMQPA
HLQKLEGSIFINSLIGFLFYPFDDEALDNVVKTMNEFMEKQQQIDVTYLRSYEATISLPT
ENGLPFSYTVDSPTLVKIHASFNKPDSKRKTGLLNALIANKVQRRIGFATLFNHKTFVVG
IDTNRHMQIPIKYEIETDKRNIGVTIIPKTLQSLEDSTKDSLKDSELSLWHHSTVPFTTR
QDIDDLRPLSFNKNLHHVLSSRKDKTVVQKGLLSLELEVDEGHGDVRQEKLMDLLPKLLN
PWEEMSLNHYMKLNMKVVPQQWDSQEINVNIAYDELEITGNKQDLNVETLTSSPVDNKPN
SEDRRQQIMRSLSRDLTTGNAYVLDISCNVPMLENGQQVLTIGLVNSNPERMSKAYVYWN
NRTPGKEEVTYEVCYLQELQQSSDTLNLMRALETTPQSHFKGNLYFGQTCQEGNQVEIIG
LMQRSNELKEIIKETDVVKECQRGIEEGNQKMPACQRAVELANIEDQLDISITAPSVVRN
IIDRVIEYVLDHFIPSTARTDVTHPKNSDIDHLEIKIILPSNDVMPKISVHTPKMDVTYP
HPSESTPEIRKMRNEFPLAGELPNDMCTVDRNMVVTFDQVAYPVKMGYCKHVLMITNPQL
DSEDGQASIPEEQKVAVLAYETRESLNTILLLGNQEIKLLKKEGHVEVLIDERPIELSEH
TPYKEVQEETHKKSLEILKLADESIEVFSHKYKLRALYDGNHIQLQASNKYRNAVRGLCG
NYDMQSDNDFMTPKNCVLRKSEEFAATFALTNEDDCQGPAMTNKQKAEEAVCTEMHPQPS
NVINDKEAGRTSTEKQSNRGRTQENESSKSVEMNEGSNNILFRTRVFQEGNEVCFTTRPL
STCAEGTRPTQTKTKEYKVHCLTKNEESLELKLGAVVADHQNGWETENEYHFRVQSRTLT
ALNKLAQQFSGILINGALIVQVKSPDTLQAIISKTQYAPVHQVLSEGWDSEITDLEFREL
SLSGKSFEIKLKHGVIRDVLVDRDVPTWEVNLLKSIVSQLQIDTQGENVIASRGTQVPDE
NQPFGSFRAMEDSVGGKCEVLYDITPLRDDVIFKQPELMPLPNLRGDGYHFDIIKTKNYT
RCEQRMAYHFDIAGKANWKPGSNDGVLSRSSTSRILISGNLKRFTIQSSVTTDKILITSK
IHDTYSGAVYSKVNVTLDHVQKISNIMPASDNSVSTGNLVYIYNNPFSNQRKPRRPSISR
SSLAARSSESRSSNSSSEESSDDDSSSSSSSSSSNNSNSEEREYLQSKPKLDEVPENPFL
PYFIGYKGKSIKESQENYSQVAVRLIGQITGEIEYIAVDILHQPFTETVERFTILNRLIR
TMDTKQLAEVENMLSDTFYQDDRNRFSNKDEKDEYDKVSWNVFSSAVAHAGTGPALITIR
NWITNGKLKDMRAVQAISKIPKVAQAPTTEYVKAVFELIIDEQVTKQKLLNTTAPLAFAE
LASNVYNNRSSIYPIYSFGRMVPKHDNALLETYIPYMATQLKEAIKDGDSRRIQTYIMAL
GNFGHAKVFSIFEPYLEGTLPLSKYQRMMMVISFGKLAENFPRVTRSIAYKIYINVMETY
EVRCAAVYIIMKTNPPLAMLQRMAEFTNQDASKQVNAAVKSSIEALANLKQPELQDLANK
ARIAKTLLNPWNYSSEYSQTVIQEMIVASLNFAQREIFQIIGSNDGSWFKSVLLGEDLSY
GGFNLPPTKLIYTISSLIEAIQSMKDTFKRVWGEDKNEEKVAIEEMIAQLNIKQDDLEHF
EGSILMNTLFSSFFYPFDNNTIEEIMRVLKTDMISWREPGSFGSKNINYLNNYEVMLGFP
TESGLPFIYTLSLANLMRINGDASHNMKPDNIEVTVAGHLLYKERIQSRIGVVTPFEHRH
YIAGIDTNTQFFIPCSARVAMIEAKRFELKIHPDEIYKYGTGHIGIHHSSHPYTARHDIL
EFQPVILSNDTRIMHTAEPHTINVAAGDVIIVATADDFDDSKDTSFEEMQEIWNAFKFNS
GGARYRNFSSIIFIRPAEVNITLHAMIINPDKLDLEPTEEAIPAITDKQTDSEERRDQFL
REVSRDINSPVAYIFDLGFASESSKQVYTLATSQSNVDEKYQALFYWNIQTPEEGEVYAE
VCGAGQLQVSPSNPLNFEKAIEQIPKDEFSAELRFGSCTNGERIKLKGNLTRTDRAKETA
MKSEVIAKCRQEMAQGNKGLLACQEAIELLEERDRLMVSMEMKSNRLSMLVNNAIFSIKT
ILPDENVKMLSPGDVKENTIDMEINVPSKSNNGKISLRTSEVGVTFSLADAVKNIPEQKQ
KENFLCTLDKTKAATFDDNVYPLKLGKCWHVMMTTFPKRNPNNPEKLLTIPENSQVLIKV
REMDDGSKEVKMIFGCKEIYLRKRDDRLEVTVDGKTEEFSQHKSYADDDNTFEIYELHDG
SINVYSEKHKINAIYDGERIQVEAHRKYRNSIRGLCGNYDLRSDNDFIIPKNCVLTRPEE
FTASYILIDEECQGSVLENKRKAEKSTCIAKSYRPSDVISDREAGRAPSKNKWGYH
Download sequence
Identical sequences Pbar_Yp1-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]