SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for pbar_TEP7-1 from Pogonomyrmex barbatus v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  pbar_TEP7-1
Domain Number 1 Region: 859-1154
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.75e-87
Family Complement components 0.0000189
Further Details:      
 
Domain Number 2 Region: 1224-1355
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.36e-33
Family Alpha-macroglobulin receptor domain 0.00044
Further Details:      
 
Domain Number 3 Region: 691-803
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) pbar_TEP7-1
Sequence length 1664
Comment protein AED:1 QI:0|0|0|0|0|0|22|367|1664
Sequence
MAQLKFTLSSEPSPGTWEIKVEKRRSQPQLVHTTVFEVKKYVLPRFQVTITSPGYILADA
ENVTWNICAKYSYGKPVKGKLLLKSTPQIPTWRRKPNLPEIHYETELDSPDGCTEFVLSG
AVLGLAQWKVAPNNIVLIANFTETGTGIVETTISRTVVVHQTLKLEFLPYTPKYFKLGLP
YHGKLRVSRHDDTPAPHEKIQLCVRVRGKDEWLRVVVECRNFTSSSDGFVDFVVPPPHKN
IVLLSFVATGVDYPTKYYSPDTRWRVFMDQPSAHIEVNPWYSPSDSYLAVARGYQPIVCG
EKYSFNVMYTVPAKSKSNESISFHYSINSKGDLLIYGHVKHRPTRDTVLNYSEFRNLLGA
VETPGNKTDQGTVAHRFPLSVKITPSMAPVSELLLYYVRLDGEIIATTYSIKVGHCFENK
VKTAWHTDAQTPGTATQYHVEAAPWSLCGISAVDKSTRFLAGAKANLIDADQIFERLKRF
MEPLEPEPRPIWTWTHCKATSYEETMNVEFDHLPMPAFEESPTWARKRRRRTAIYNGLVN
YVDAIQAFDDFGAVVMSDLILETRPCLQRLRLRGRARSRSKSPIPFLSASSEPLPDTVDA
GMFKMAKTLPMAYPLLNVGPEQGGYVDQVPDQPTLRSYFPETWLWELVPTGKEGKVTVER
TLPHSITDWIGYTACVSPTHGLGIAPPTTITGFQPFFLDYSLPYSVKRGEMLRMKVSLFN
YMQHSLPVKIKLEDATGLDLHLSHAVASFCVKPRDSVVHEYILRPRVLGDVNITVSASID
SEYAEPCGPEVLLYTRDVIVKPILVLPEGFPVEMTKSAFICPKDFSDDSTITWNLELPDD
LVPESARAYVSLIGDILGPALENLDNLVRLPMGCGEQNMILFVPNIHVIGYLDATGVENP
ELRAKAVRNMEKGYQRELIYRHPDGSYSAFGPESLEDGSSIWLTAFVIKSFAQAKSIIHI
DERDLKISVKWMVKKQLENGCFPVIGRVFHKDMKGGLQDDDSSSSALTAYILISLLESGV
PLTASLINNALHCLEKGMEDDGGTTYTAALSTYALTLLEHPKANNSMKSLMKRATRNNDL
LWWEDKHKPSLGLSIEMTAYAVLSLVKLGGETNMVEALKAVRWMSKQRNAEGGFTSTQDT
VLGLEALTKYAAAMSSNTTDLSVLVTAGEVDQVYRMHNDNRMILTQIRLPVIPTIVEIFA
EGEGCVLVQSNIKYNVAHATGSEAFDLSVNAASATWVDECSMQKITICTRYKMADGESNM
ALLEIGMISGYVPDRTSLHSLLEDPATKVKRFEEDRGIVTIYFDKLINQKTCISFTVTRE
NIVDRLEPANVKLYDYYQQELTISSSYSFAPTCSSATPSEEAEIPVPIEVQQMGKDIAKK
DIVEKEGTVEIEKAAEIPDDGNGTVEQIVPQREAGSGQTPDEPDINLNPVFDRLGPPNID
LEDMEVPFSTFNKPSQDPFATDFEGNPHFVVVDHELATPEGIEGPVPVSVKPDIAYFDAY
PLNVTNETDQKIEADLSNTQLQTLPFGSNESCPVCSDELPPNINDLYCSASSVAKAAIRR
LRKARFLLDMQSSREIKRLHSTIAFVLRPNCSCPPLDNPGSLALLMHFEDSEFAKRSHNW
YILDEQVSIYGLPSIGGVPREILDARATCANQDNSASLNLPMAD
Download sequence
Identical sequences pbar_TEP7-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]