SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Wican1|24671|gw1.3.1960.1 from Wickerhamomyces anomalus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wican1|24671|gw1.3.1960.1
Domain Number 1 Region: 61-184,237-286
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.04e-17
Family Glycogenin 0.061
Further Details:      
 
Weak hits

Sequence:  jgi|Wican1|24671|gw1.3.1960.1
Domain Number - Region: 190-271
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.00068
Family Frataxin-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Wican1|24671|gw1.3.1960.1
Sequence length 446
Sequence
FAGPVKENYQQDPIYTKEFLLKFLTLNPKEVQLMKKSHSSMVKSLPKKFPDVLSSNFQPN
GYVYVGGSHFNYLVLLSLKSLRASGSVFPVEVLIPKMVEFDVELCNYIFPLYNAKCLVIE
DFITKETSKKINKYQMKSIALLINSFKNVMLLDSDNMILKNPDYLFLNEPFKSKGFISWP
DLWRRATSPFFYKISGVSINDYKKIRNSYWHILKKQFHDIKPDWLYSYHDFEGTIQETSS
ESGQLLINRETHAKTIFLSTYYNFYGPDHYYPLLTQNSHGEGDKETYISAAHALGQTYYQ
VEEFARDFHKNHHRVKFGRQRDIIGIGQYDPMIDYNRSTLMTLEESKRNDVDQFKYSSGH
SIWEYKIWNQSELMFLHCNWPKLYTWDLINSKGIRSFKNAKGKRQRLYDGLINELGGKRD
FELEIVGYMKWYFCEHKDLQIRGVFN
Download sequence
Identical sequences A0A1E3P2H1
jgi|Wican1|24671|gw1.3.1960.1 XP_019038802.1.93583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]