SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH10540-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH10540-PA
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily CutC-like 0.00000017
Family CutC-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH10540-PA
Sequence length 92
Comment maker-scf7180001003956-snap-gene-0.1-mRNA-1 protein AED:0.255287009063444 QI:47|0|0|1|0|0|2|1|92
Sequence
MICIRSSNFVYGYEELDALTLYDLKILKHHEVNGLVFGALIADCKIDLSHVKNRFRYTTL
AEIIANLGFQKILTMRQKNTALEKLELIKALL
Download sequence
Identical sequences LH10540-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]