SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH13336-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH13336-PA
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000162
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH13336-PA
Sequence length 370
Comment genemark-scf7180001004684-abinit-gene-0.25-mRNA-1 protein AED:0.0589114469306679 QI:0|0.5|0.42|0.85|1|1|7|249|370
Sequence
MALSQTSVLKLYNTVIEDVIAGVRESFIDEGVDEQVLQELKQIWEAKLMSSKAVELNPDP
PEPQVPPINTHKTVSVTKGNHFVQSSAGNSVSQTSQQQSQQPQQQQQAQSQQQQTSQPQQ
HTSTTGTTVQQQQHSTTPVQQVVNAPAAVLDRQVPIQITLPPQAGVPDGPQRILSIQVPA
STLQGNQLQTILTGPIISAAMGLPANLASTLLQQHVNSTLQGQATLAPLQVNQPIQVVTQ
STNSIVTQRPPQNQQQQNNINQMDGGVGDSTDDDDEEEEEDNDEDDEDLDDREEEENDEA
ATREEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKITRSRNKWKFYLKDGIMNLSGKDYV
FQKANGDAEW
Download sequence
Identical sequences XP_012215668.1.42766 LH13336-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]