SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH14926-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LH14926-PA
Domain Number - Region: 392-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00338
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 81-131
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0217
Family BRCA2 helical domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LH14926-PA
Sequence length 544
Comment maker-scf7180001004837-snap-gene-1.21-mRNA-1 protein AED:0.030568074003795 QI:0|0|0|0.5|1|0.5|2|0|544
Sequence
RVYHETVINLKALINKEIDYTSFPKVHTDVINRKTTVTTFPDITFYGSVNSDTESIEDMA
RNRKSRVKTRNNAKKLQIDMKTKSRICNHCHNIVANGIDMYRFHRTGLTVCKGCWLTIDP
TKGRGKKQLRKTQDSFVETKLCSVFLTDVLSEESHKSEKVYRVEKDKDGNKFFIVSDESS
LEEDKSSENSRLSISPKLENRVVNGDAQQGKKRRIDTVKSDVESTPTKVTRSNQKRTNVN
ETKSTKLFTDAEEKSIIHSTQQRHKRTRSTNDVSSDSDVPLTTAIKTRKLNNHRRLQSSS
VDSVDNQERKKLRSILKGITTNVRIELSDQSSNEGSMTPRRKTRNVPNSSNTKEVKKEIC
TRTRSSSISSMEISPSEFKSPKVVVLSEIKAEYICDECNKEFDTKLSREEHRLTHLKQAV
LKLERIIVPSEKKQQEMEVDSQEDKISEEPVACSSRTISIDKNADDLSEEIAINVEDDTD
DEEIFSVRKSESAQKKIVMNDKNDNETDKLDATEGKSSIEEESAKVINEEVITKESQQCE
ESAI
Download sequence
Identical sequences LH14926-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]