SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH16138-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH16138-PA
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 3.92e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00016
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH16138-PA
Sequence length 112
Comment maker-scf7180001004904-snap-gene-11.5-mRNA-1 protein AED:0.176409792649054 QI:0|0.33|0|0.5|1|1|4|0|112
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAIKVLLQFDKAINQALATRVKSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEVAIVDKVKIVACDGKTLDADGTAKR
Download sequence
Identical sequences LH16138-PA XP_012219483.1.42766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]