SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LH16150-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH16150-PA
Domain Number 1 Region: 105-254
Classification Level Classification E-value
Superfamily Spectrin repeat 8.28e-34
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 2 Region: 14-143
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-28
Family Spectrin repeat 0.0000335
Further Details:      
 
Domain Number 3 Region: 259-301
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LH16150-PA
Sequence length 301
Comment maker-scf7180001004904-augustus-gene-12.8-mRNA-1 protein AED:0.147465437788018 QI:0|0|0|0|1|0.66|3|0|301
Sequence
MDQITPKEVKILENPEDIQERREQVLGRYANFKSEARNKRDKLEDSRRFQYFKRDADELE
GWIYEKLQAASDESYKDPTNLQAKIQKHQAFEAEVAAHSNAIVLLDNTGSEMIAQHHFAS
DVIRKRLEELHRLWELLLSRLADKGLKLQQALVLVQFIRHCDEVMFWIHDKEAFVTTDEF
GLDLEHVEVLQRKFDEFQKDMASQEYRVTEVNELADKLLLDGHPERDTILRRKEELNESW
QRLKQLATLRQEKLFGAHEIQRFNRDADETMAWIAEKDVVLSSDDFGRDLASVQTLQRKH
E
Download sequence
Identical sequences LH16150-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]