SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH18212-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH18212-PA
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily CutC-like 5.62e-68
Family CutC-like 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LH18212-PA
Sequence length 242
Comment maker-scf7180001004940-augustus-gene-23.6-mRNA-1 protein AED:0.0302304526748971 QI:0|-1|0|1|-1|1|1|0|242
Sequence
MEICIDSLESARNAIEGGASRLEVCMALSEGGLTPSPGLIKQIKTLATIPLYAMIRIRNG
DFIYSHEELDAMLHDLKILKDHEVNGFVFGALTADCEIDIVACERIISAARPLPVTFHRA
FDLTNDPLKSMEIIANLGFQRILTSGQKNTALEGLELIKVLLQKAPKHLIIMPGAGITRD
NIQKIMESGAKEFHASAKRKKIMTYNANKVRMGTGEDNFINVTNRELVKDLVNIIKSQCT
AS
Download sequence
Identical sequences XP_012222858.1.42766 LH18212-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]