SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH18214-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH18214-PA
Domain Number 1 Region: 21-193
Classification Level Classification E-value
Superfamily CutC-like 3.4e-30
Family CutC-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH18214-PA
Sequence length 208
Comment maker-scf7180001004940-snap-gene-23.17-mRNA-1 protein AED:0.0176054981546971 QI:1|0|0|1|0|0|2|2|208
Sequence
ICAKRSKKQLADWRFVRLSRSGNLIPSAGLIQQIKTLTIITLYVMICIRSGNFVYGYEEL
DAMLHDLKILKHHEVNVFVFGAQLQNRLVACERIVSTTRLLPMTFQHAFDLTNNCLKSIE
IISNLGFQRILTLGQKNTALEKLELIKALLQNGLIIIPGVDITKNNIQKIMEPGAKQFHV
LAKRKKIVTYVNKVRMGTSKNDFVNVKN
Download sequence
Identical sequences LH18214-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]