SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH18216-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH18216-PA
Domain Number 1 Region: 44-253
Classification Level Classification E-value
Superfamily CutC-like 1.57e-27
Family CutC-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH18216-PA
Sequence length 259
Comment maker-scf7180001004940-snap-gene-23.15-mRNA-1 protein AED:0.0724396571170765 QI:0|0|0|1|0|0.5|2|0|259
Sequence
MQIQYCTCKKININQSINRLAIYYTLYQLLKICAKRSKKQLAGAANWRFVRFSRSGNLIP
SAGLIQQIKTLTTIALYVKICIRSGNFVYGYEELDAMLYDLKILKHHEVNGLVFGLLIGD
CKIDLSHNRFRYTTLAMTFQHAFDPTNNCLKSIEIIANLGFQKILTMRQKNTALEKLELI
KALLQNNLIIMAGVDITKNNIQKIMGPGAKQFHALAKKKIVTYVNKVKMGTSKEDFVNVK
NRELVKQLINIFKNQCTAP
Download sequence
Identical sequences LH18216-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]