SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH18218-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH18218-PA
Domain Number 1 Region: 15-101
Classification Level Classification E-value
Superfamily CutC-like 0.00000000000445
Family CutC-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LH18218-PA
Sequence length 116
Comment maker-scf7180001004940-augustus-gene-23.3-mRNA-1 protein AED:0.266234404165439 QI:0|-1|0|1|-1|1|1|0|116
Sequence
MRKNRFCCTSLAGDHAFDLTNDCLKSTEVIANLGFQRILTLGQKNTALEKLKPIKALLQK
NLIIMPGVDITKNNIQKIMEPGAKQFHALANRKKIVTYVNKVRMGTSKDDFVNVKN
Download sequence
Identical sequences LH18218-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]