SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH10797-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH10797-PA
Domain Number 1 Region: 1388-1624
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000216
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number 2 Region: 1604-1795
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0038
Further Details:      
 
Weak hits

Sequence:  LH10797-PA
Domain Number - Region: 254-484
Classification Level Classification E-value
Superfamily Tropomyosin 0.00085
Family Tropomyosin 0.0072
Further Details:      
 
Domain Number - Region: 71-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0125
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1084-1316
Classification Level Classification E-value
Superfamily Tropomyosin 0.0458
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH10797-PA
Sequence length 1936
Comment genemark-scf7180001004320-abinit-gene-0.30-mRNA-1 protein AED:0.100543710648933 QI:0|0|0|0.6|1|1|25|0|1936
Sequence
MDTTRSGGAVEEQNSDESLSPDALVRQNYELRHRLEEEAASYKRRLDTYRQAQQHQAALV
SRLQAKANIVLQYKQRCSELENQMAETVPIVCDTTRPATVSSTSVLETAHQTLRDIREEQ
IHDLDTALKKLGEERRKYEELLQLNATLKDQLEESHQTNEALTNDLQKLSNDWDVLREEL
VIKEDEWKDEEQAFNEYYISEHNRLLNLWRDVVSVKRLFAEMKSATERDLSKLRNEIISS
SNEMTSACNSTNFTMKLQATTAAQSTPSHRMQQQEEEHATTILKTEIATLKQQHAADQHE
IRTKDDRIDQLIREIRNLEERCSVSEAVVTQTERMQEDIEVLESALRDIAHTVIQDAECR
DTDAKQTSTHIHLSSSGPIPQRSPKRSARSSTMPAFAESTISAVRAALQKYQLTIRELQV
KLQTNKEQLLTMRKQCDTTETNAQMLNTKVTELISQLDSCHSQCTQLSQEKEMLQKALDT
VKLEKNALDKNKVELNNTIEALKSNCEKLQKTNNKLQKLCDNLEDEKMYLQNELSRVSED
VDLKELSLRSEEDKCSKMREELLTLREDLNKAYLAKDMLEQHKLETDALISQIEKNKGDL
ELELERILLEKSDMQEILIKMEAMCSNHEQDKQRLQEELKKVVDEKNKLANQCVDQQGDL
NSLRKELLQAEQIRLDIESEKVTLNEKIKFLEIEKEKVEIELGQVTRERNDLSNQLSILA
RKKETLNEELMRLRQRLEQSNEMNARINRSLKDLVKDNEEKQVLLETNEKEFQKLQEQLA
SMRTEKEILEGVVFDTQTNLEATHVKKTQLEKEQKEILVKQESLKGQVTRLTKELENSEK
HARDIKQSLTQQSGDQVAEFQQIISNMKKQSEDNTRKMNDEKEQVRISLEKRLQQSLSQL
EGEKTEEINHLQQRIEEMQQHIENLCKQHEEVLLRAENDKQQALLIAHHEQQALIEKIDT
IMRELEEEKNILERVKREAAARAEQERNNTNQLRDELNRLKTRLDETKLKANEEKMKFDL
KIEELWKERESTQREVEELQVQLHMTEDKVDGLQNQLHDTVRKLKDADNVNETLRKELVD
IRRQLADTTYEKEKYNNSNKELREHVKQIESERREQGRTLEESYQKISALEDAKATMDTE
RTRLQAQMRDMERDALQLQQQLRFTQDELQKSHENNAQAQNEEKELQARLANEIEERERI
QLQLHQVKKQVVDLDNSLEVTRQELGKLRTRADEEDERWHAREQELLVRLEDGRCRERKL
EDQKHNLEVCLADATQQLQELKARLGGSEGRVRALDAQLSQLETAKKEVEQKLSSVGSTL
RRIAGIQMDGSVNMPFKLMSPSRRWSPARAQDHGDTSRDIVLDVDPEAVRKGVRSLMQQV
AQIERERDDYKTELCGLKKQLNESQENQNNTDVKVNNLLTNIRTLQEEKKSLEAKLIQKQ
TSYQAQSDAFQKKTEECDQLCEKLTTLELKMNSESEEKSQYEDKLEKMKQELNRLETEKR
NLQKEIRHSESHATEMELQRMSLDGDLQRLQMMLQEKEAHIQKLQDRFDTQSRTMTSLEE
RCGSLKSTIEQLKLALEKASVTESELKDEINLMRLNVMEITTSSESNNEKLKQLQKQLSN
TENERRILSERLETVQQTLYDLKHTNQSLIDQNARLQNELANNEVQRSALESQLRLSTWP
PESASIKDEELLRQLQTAQRERSEMRGKIDALNDKVKLLEADKRNLERQIASSKSNIIRS
KSYERPEKAHIELLGTSYSLDNLEHENRELRLKVRKLETQLAEKEADLIRIKSTYIHSSH
SLLDASRDRSGELERIRAAQLQAEKLLEAREQSHRQQVSRLENQIQLLREQLNQEIKRRQ
LYVLRSTRAGREMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDSTLTSTTSLPPSLA
LPAPPSYRSSTPSQFK
Download sequence
Identical sequences LH10797-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]