SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH16941-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH16941-PA
Domain Number 1 Region: 984-1095
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-22
Family PDZ domain 0.0000981
Further Details:      
 
Domain Number 2 Region: 238-334
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-22
Family Ras-binding domain, RBD 0.00027
Further Details:      
 
Domain Number 3 Region: 360-472
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.11e-19
Family FHA domain 0.00012
Further Details:      
 
Domain Number 4 Region: 42-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.96e-17
Family Ras-binding domain, RBD 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH16941-PA
Sequence length 3114
Comment genemark-scf7180001004924-abinit-gene-16.62-mRNA-1 protein AED:0.159886219347829 QI:0|0.61|0.59|0.92|1|1|27|0|3114
Sequence
MATELANKKAEREALRGVIQQWNANRLDLFELSEPNEDLEFHGVMRFYFQDSGQKVATKC
IRVASDATSQAVIETLIEKFRPDMRMLSIPEYALYEIHENGEERKLGLEEKPLLVQLNWH
IDDREGRFLLRRIDDKTNAQGVGLISDGSSFRRKLSKREKKQIKKQEKLSRLKSLEQDEN
AAPGDQNGVAEKLYTELPETSFTRSISNPEAVMRRRRQQKLERKLQQFRSKDGGPDTGGT
LKIYGEALCKDVPYKTLLLSVRDSAAQVVREMLSKYGLDKVDSQLYCLVQVNSENMGSNV
HQEYILDDDECPLAILMNHPSTRGSIMFHVRRRPADYMPRKRKKKPAGKWNELDHRYEDE
RLPFLLELNSDGSDIPNGAGVRHRLQPNVTEVGSERPIGPQAVQAQTLTLPGPTVMPRHC
VIAFTENIVTLTPCSRDAHTYVNNQRIHQTTILQNGAIVKFGRMYTFRFIDPAPEERIRQ
RHDSNKQIDYAYDRRSPDATSQDVSSEKFHPGSATSNGSGGQTPGQTQERAAPSSPSKSA
AVAARSPRSPTHPPESTHNYETTFDLDGNVETASLSSSRDGNRLSQYDRQAWGADPILPA
VLEFLEETEEAFLHAVITDVEPSAPQFKLAPTYTLYLSARYRASTHYRPELQPTERAHRL
TLMLANVATMIQRVIQERYMNASSLAFWLANGSELLHMLKSDRHVGAFSTRAQDILVDAV
HTAFGSLVRCVTLELTPAMTQFMADADEPAKEAGVLQIFSNTMTLLRRCRVNAALTIQLF
SHLFHAINATAFNTLVSNGNLCVRWFGRRLKARLNALETWAERQGLELASQCHLATIMQA
THLLQAPKYNAEELATLSSTCFKLNSLQVRALLQKYQPATDEPRLPAELIENVVRVAESV
ADTLARADGREIRLEEEPVLGLALLLPEDGYSCEVIRGVPPGLAEFLAPLQRDGLCRMAA
QPTSSGYWTIYMIDHHNNMRSPSAMSNRSGGYVGHINQNQAQPEIQVIKLHKSTNGMGLS
IVAAKGAGQDRLGIYIKSVVAGGAADADGRLTAGDQLLKVDGQSLVGITQEKAAEYLVRT
GPIVTLEVAKQGAIYHGLATLLSQPSPVMTRAYKTRPKSELLEPAVGAAEATGGQPAASR
SMGDLLSFPKRATSQSLAQPGATTSQCAIEAPFYPNRPIDRGFPRSDPTESRFAQQDPFS
ACRPRSAYHRAFYPVDEFRGAVDRREYSCRPSTPTVSPVRLPGLRMPCPLISITCDNEMP
SIVYQDDESDGKITEEDESAAERGEIAAGDSTDSFDPFERIATPPREYAEAAIDYKHSLL
ARPLALHTNVFDNIPYIDQTDDANFTESSECVEGERRECKRCDKGDCDGNSNFRDSQKCV
ATADRRRAATSQESDFEFDACCDVKCSSTDASPLTNELVVKDATIAPGFVTESPSNDSLR
LGSLNTGAKRTLNIDEQDKLDDISNSDYADESSSTIYDDDGSNRDAGEEISTSKMYTAMP
ELHLDLSGLNSDISSDESKTEKCWKSPEEVRLGCGRVAALAKHFSKLGDAGLIKFKTTKL
TDFRQFVSEPNITASETSGVPSRAQKGCKSDSDLAREANGNVQIGENGDLISTSVETDDD
LAIEECRFHRCGAKRVTVSGTSSLNEERVDARKNSVPTTDDEDCDANESRLAGDCKSTPV
ERVGKMEDSSRLSLKQQQVIAQQLEQFSNLDDTDAPLFIPEQSAKRASSVSLKSETDGGA
SAFGDSTRSNLTDQAATASRERLPSSSDGRTRQQASSPPLSSSLPSVHFPSSSVALSLSN
VKNSLSAEDKSQVYRYVSEKYPNSRLFLDISYSSAKSCSDDNLKSLALPSRANVHLRSQD
DKFDTLRVQIARPLCRSENNLIGAAICEREEACHGGSHAKLTRNCKNTPSCKRLSADEME
LSENPCQEIDSSRDGAKNAKLEGKARSYHRSLEELKLNKRGISSASSASTRIVQVPKRFD
DKLDSENKRGTRWNRHRSFEVLKSRRELSEQHSRMNPAAELPREKSRAKRVSHDWPRGSA
LELSRGSETEDEERQRWRTKRKSRSELDISKRKPDLERNDWSFREISSLNDQSASRPRRM
SERDLSSRLGYDATPQQIHSSKSVPALHNMGTEVKQQHEVFNPGYSRASSSNSVTPPVQP
PPMATINSATALRSRSSHNLHDPMRAGALPPTGLVSRQQSSPNLNPNVTHANVPLNAQNT
EVERFYQNLSIYRNQEAALKQQLSPQQSDDRNLQHNQNQKNTLRGSQNSLNRPSTLEATN
YIRDRPTSAYVTQGQQQSYSAVGSQMQQQNVGPSSRSQSTRDIIRQEAKMQEMQEEVRRR
ELRGGAPMLGQHRPPMYNVGARGVAPATQQAPPNALSVALPKPSLGSTSNLGVASGYAAR
QNAPGYNYTDIQHVQHNNAQYNQYGQYNQYPNRYPVSGGQYGSMLLKPKNEAVIRGHQSM
PHESPLGKDQHNQQEAKASAEQSRHFAGSQNSPHYPNGSLEQRVDQYTNDGMINRAQNGE
SNPAATSEVPPTRPTLPSEEFNESPPPPPPDTSTHPLYNKQADMRYMASMQDPPRGSYYP
AGGISAMQQPRQYQYSATNPWQREEREKEQARRREAARQWRDQQIAELSALTHRTQQQEE
QLRALQLERDFQKRAEEAANQDDDEESNDLDNESTQRIQDLFRMAASQERTIQGTQQPPI
LSRTNVGNQSIRGGLSLQLVGNQPVISGHTHILSGQAATQNVGASGADQEGGDLHVQSSH
QQQQQQQQQQRMPANQSEEQMHMPTNYGTPLGSHFSSGQKSYSMGMLHSIEDKELQRKMD
ETKRKQADLEESQKKQEEHQLHSQQQAYQQSQHARSQQSLHPSMLRLDNLIINGSNVPMH
GNSLGIFMFFVNVEIADVVYFCPLQHNINDAPPPPERGSSYAVMSQQNALRSNSSIASNL
PPASQQPPSLKRVSFHDSNANSEPTLRNVSSATPNPPSFSMNTIREDPNNFINDAENLLA
SPKTPEGSGTSFSGATPGVIGAQEVYKDPRQKRLAEKQKQQNLQIGAVPEKLSFKEKMKM
FAMETGEDGTPRDKVKISRAQREIDNISSPLNSNNNNNNINNISGNNNTNSNRT
Download sequence
Identical sequences LH16941-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]