SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH17335-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH17335-PA
Domain Number 1 Region: 22-222
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000141
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH17335-PA
Sequence length 307
Comment augustus-scf7180001004926-abinit-gene-32.111-mRNA-1 protein AED:0.23860967590418 QI:15|1|0.66|1|1|1|3|174|307
Sequence
MIVETLIPLFLAIHIPVEDGTWQHGPEYIFAVNMNMTRTPRCPEYDPSCGEPSGSRIKSR
LHCYPTKDNSLVCSLRQVEGYDIGVSEEDGHIVNRRKTVTDAPIELLYDDEGIERVIASL
QTKPYDLNILKTVAEQLHTGDDFDDIGHGTFLGTARSTIGKCNVSFAVQRRPSIGNAVRG
RRGFLLQPLPEGLRLGHGETIVIDKIVHLDNCSCYAENYYRRYSDRVVCEDGQADLERMT
SRMEISVTSFASSTTRTGTVDSDDRTYDVTEVTQVILEDIQPAARDLPVIEKPGQTLIEA
NYAITKM
Download sequence
Identical sequences XP_012221461.1.42766 LH17335-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]