SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH21009-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH21009-PA
Domain Number 1 Region: 3-126,157-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-72
Family Calponin-homology domain, CH-domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 3002-3126
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 3430-3587
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-20
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 6289-6443
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 4072-4227
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-19
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 4503-4644
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000168
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 7 Region: 6598-6714
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000792
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 5320-5463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000151
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 9 Region: 1526-1657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000017
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 10 Region: 3861-3982
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000792
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 11 Region: 2490-2627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000228
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 2382-2517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000314
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 5022-5157
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000423
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 14 Region: 2792-2915
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000828
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 5692-5807
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 16 Region: 4721-4860
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000018
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 3648-3770
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000587
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 18 Region: 4877-4977
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 5533-5652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000413
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 20 Region: 1930-2049
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000047
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 21 Region: 1629-1767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000471
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 22 Region: 4230-4341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000563
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 23 Region: 713-819
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000072
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 24 Region: 963-1115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000108
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 25 Region: 485-618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000298
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 26 Region: 785-911
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000348
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 27 Region: 6812-6964
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000372
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 5166-5268
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000576
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 29 Region: 3340-3475
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000105
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 30 Region: 7188-7295
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000204
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 31 Region: 1398-1519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000209
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 32 Region: 3218-3340
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000498
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 6067-6220
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000156
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 34 Region: 1290-1417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000257
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 3981-4086
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000324
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 36 Region: 7468-7577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000304
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 37 Region: 2037-2187
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000128
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 38 Region: 1128-1236
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000396
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 4631-4729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000987
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 40 Region: 6916-7063
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number 41 Region: 258-419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000067
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 42 Region: 3134-3230
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000936
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  LH21009-PA
Domain Number - Region: 2915-2992
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000134
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 2635-2737
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000237
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 7384-7496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000959
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 4396-4474
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00352
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 6722-6811
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0176
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 7290-7398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3779-3850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 7047-7136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LH21009-PA
Sequence length 7582
Comment maker-scf7180001005004-augustus-gene-2.10-mRNA-1 protein AED:0.0611167604243977 QI:0|0.11|0.11|0.13|0.94|0.94|36|455|7582
Sequence
MTLTMNDEQERVQKKTFINWINSHLSKRVPPLRVDDLIEDLKDGTRLLALLEVLSGEKLP
VERGRNLKRPHFLSNANTALQFLQSKKIKLVNINSSDLVDGRPPVVLGLIWTIILYFQIE
ENTRALEYLGHTWGSQSSLESLGTQGSAASERKRISSERWKQSARKTLLQWVTNALPKNV
GIQVRDFGESWRDGNAFLAIIDAIRANLVNIAAMREASNKARLETAFQVAEIELGIARLL
DPEDVDVPQPDEKSIMTYVAQFLHKYPEPGNTGPDSFAAIQEEYDGLLNWLNERVRHLEQ
LDRTNAFPRSYPMLHWLWLLDSALPGELGEAGRWLARAEALLHSDNDIPAEMTEGTANII
SNKLEDHKKFFLDLSAMTEKFQHAKNSPLARQVQPEQLENMSARFDSLPDRAAKRRIKLK
FLEHKCCLIAFLYLVETKLKSWNVKYGTEEKVHQMLEQYRNFVSRNRIFQEFQKAYLDMQ
NVADEYKRDGDIDREESFNIDRFLRETADKWKNVSMDLRCVQSMLEEVVAYWRRWTIVSD
EFEAWLLRAEPALSLPEDERMEFFQDISVWKDKHQQLSDTVSFLIATSDESVAYRLKERY
ANLTARWEQLFQEAKQYMHAGDLIRTRKDYKAGVETLQKWLRNSEAALSTTGLSSTERIK
AYGEKLQALTTRMMNTLKKEKEALVKVRALIPMQLHLYHQLLVQQESLEAGQKEISAWLD
EAENFLASINLAGGRDAALAQLDRHKAFFSRTLYYKSMLESKNKVFASIVKAVDSHADVE
TAEGGATLRELNNRFARVSQAAQVWEQRLQESVRRWTKFKECERQISEWLSVAETMINDK
HIDNRQSVEHHKNFFGKINEKWIQDLVKAGQDLRNVLPADQQLPIASTVEALQNRWREVL
TFAPLHLMRLEFRLDEASFLQYLKEIEMEISSEQQALINNDDVDGIQQRNREFFVNRGTV
LEVERCLQTLKKISDAYSKHKPRDTTLADAAQNAERMWEETAQKVENLREQLREVPQQWA
AYRQKFDEMVHWMDHVDSTLRTILREVNTLEEFEKEKAIFQKICREADSKREEMKWLVQT
LDNLTLNRSDREALTAQQNLEHLITRYKNLIPTIEITMTKTDIYSKSYTYRKEVREVCTL
LRKVREQSKVEVTPEVPEKLQSAVAHQESRLNQLEQQRATIVSMLQRGKDLLKDQHAPPF
VSSEVQQLESNWNDTYGQSMETLKSLKDSQKLWSTYHEQRDEILRLIEQAEQELRQIEST
SYYDAGQVTSDLQKKQEFNANLRKSAEEMMRKLRETYTNLAQTLTPPSKKDSLEKEVTET
EKKLEHTLKTVREKVVYLQEHSTRWNKFQSKFIELRSWIQQAAPQSIADIEDSAASPEER
VRKTENLQKEIKEKASILNILEDESRKLVKLDSDDAPAKQLRADFENLHKAVELLNKSIV
TQRELATKNLATWKEYEEGIQKIKPWIEQAESKAATMGSKPTTLAQATQMLESAKAFEIQ
CQQHLPKVQTLSTISQQIAGRTVAPDEVDAVYTRWNAVHDVAVQTTTKLDKLVLSWNTFE
SEAKEFNEWLQNSEREALKEPNVQTPEAAKLEKELARLKEFNKSISNHQAQLISLTQVSD
HISHGLSLEGASALKGRVAEMKARVSKLADTVRHHINRVSDSLLARQEFQIKITDFENWM
TRLRSNINEIGDVGVDNVDANLQAVHAYLQEHSEKQPTFAAIYDEVKQLSSRGSVPEVAA
LDETYTSLAKKYKALEDDLREKKKGLEKWIELLSWHNDANAQLSHYKYETEARKPTIADL
NRLSSDLEAVYAKINTWKEHVPLMDSTLGIHVRDKQERPVTATTLLNDLESKAAVLKTEL
SAKRDKLENLGAKWDNFRKLQQKITEEIVNTQTCLQDITYAVDTCEKLAPAIEKIDDLIE
DHQRREPEKEVLHREGDNLMKEDQRAITNIQVVVSSVDGNWEKVNELLREQRKKYAEMDA
DWKQYKEAREKLNKFIDEAKSLCQSVRDVSTDITQANVALEKHKRASDILKKGKQFLDKM
DAKAQQLAKEASLMPNFKTNLIESDLSDARKKYQKIYAKVIDRTQMHETQVIIWKQIEEA
KCNLTRWLSDTNEALTAACERLLDAENGQARLTRYREELPAHQQLRRGIATKTEQLVKLN
DDTDIPTLRSLNNLLDDQFKVVKEAADKLASLTSTLNEKEKGIKQELKKCSDAISKVREE
IIKCDDLTGENTKILHRINKCQELKTELEKCDYALSEIDEKLTNMASEYPAISKSSLPKE
LQALQLRRDGVASHADKVNATLVAFLTKLYHEKFGALQRMVATHKEKVAWCEPEQSSDRY
NLEVKMASLADVETGIADCETRKVDTDNSLKLLGTVESGKTTAALKSERDKVAADLEALK
ISYRKIKSVLEQNIALWQRYELTSENVISWLKENESKIRVEATTLLNLDEINAKIAEMTQ
LEKEVKNYEGEVKDLMALGEEITKVSPESRVAQYVGHLSTRYHSVLKFLAQHLNRLGELK
QIRGQYADNVKELESWLQKAEQKLRVYDEISGPKPITFYQSRLKELKAFAEEREIGQGIL
NRTAEAGETLFARITPDHRELIRGELRNLRSRVEALADRANVIYKKIESDMMHRSSFEDK
YSQVKQWVIEARKKLGDKQDLLPTLQEKKLALHLYKAIAQDVGVHRNILQQLQGRLGAMP
DDEASEMLNSVIEAHEKLSEDVENRINVAEKHVANHEAYLQTFEKTRDWINTVVNETASV
SEDLSIDRDAAKSRIALIENVLQQKPEGDRVLADCNQQLNIILEQTSIAGHPALLKGFEQ
QEKIWEDFLKRCIASREKLNRLFDQWSEFEKMVERLESWLKQIEAQVKDQSLKSTEETKR
AHLQKLKSLEEAIVAKGAELNAAVEKSQGIEAESDLATRVSRQATKYQAIRNQAKEAVAR
YEQYVKEHSLFNERYNQFLDWITEVQGELNKHSEIVGDLAVLQSRQKHIRDLGDVRTREN
ARFESVIDLGEKLYVHTSPDGREIIRQQLRNLRTMWDGFSEDLQHSTQKLDQCLMQFAEF
SLSQEQLTAWLRDVERAMHQHTELKSSLEEKRAQLQNHRIMHQEIMSHQALVESVCDKAQ
QLVDQTKDTSLNVYLQSIKQLFQNIVAKSRDLLENLEDCCDKHHRFNLQCKCFSDWLNGE
REKLAECNDVTGERSDISRRLTSLAVLKDGQAQGAQHLAKLKELSEAVANSTAPKGREVI
KKEVIALESNLHQFLSEIVSVEERLKAALERWQNFENQLEAHTKWFRSMEAIFRDQQLQP
TLKDKEARLRAVKEKREIIARQEREIDEFVDKSHSLLHASGIERIKPLISQVSNRYQLLH
VLSKEVINRCQSIVDDHRAYEEKLKAIDVWLTPLEQNLAILKKEELGGDLEARNSRLQVL
LTEKEQAEHRLASLTSLGERILPDTSAQGREVIRHELRHARERWDRLAEGITEQQKKQDA
QSLQWTSYQETLQQILAWLNTMERAIKQDSSTVWSSLQEIRSKLLKLKTLHQEILAHKRI
IEGISEKANALVQVTQVPSDVQERVVSVSKRYENLVDASQKGISSLEALLDIFQQFHDLQ
KAYQDYQKRQWERLANYSDYTGNKAALQARLAKVVEIQDSQSEGEIKLNVLGEHVAQSAR
TLPPRSQESMERDLANLRFEYKKFATAVNDVARCIEERIQQWSEYENSLERLLAWLTDAE
TLLKNYCLKNTLEEKQEQLERYQSLIVNLRQNEADFDKMSDDSSELMQISGETRFSVSVQ
QVTSRFQSIQTTAKELVKKCEQAVVDHASYLERYKQCSEWLANTRARYHSTRENATRQEL
ISNVDTLKELLGRQSSSTLLINSTVEAGERLYPTTGTEGREIIRQQLLDLQQAFEELYDG
VALTERELQAKISRWSGFDECSEAFERWLKTVEAQLKPEIELKTTLDEKRAQLHIYRNIL
HDAQTHQQDLLDLRDKADNLPERTNKIDQTLNSLTNRYNVLLKRATKFVEKYEGIVSDHQ
QYSKAVLDTHEWLDATHNAVSLWGDVELERVSLHTNLDRLKNLLNSLPEDEPRVQQIRSL
GEKVIPGTLESGQVNIRAQIDSSQQEWEGLISAVKSTIEALENKLQQWSEFETSKERCLA
WMRDTDTILHAVDLKSTLAEKKNQLEKLRALQGEIRAKELEIDAVAERAQQLHKNATSRT
SHMSELSIKYQQISSKVKDLNNRWHQYVATHQDFDNQLAECTTWLEDIKNKLAYCCDLSA
TSQKDLEQKMDIVQDLLLYKEDGFAKVQSIVELAQAVLANTAPAGHQTINDALARLQEQW
SALASKMLETKTNLDDSINKWAGLLEQIQSVNKTVEYMQMSIDEISQFQTTMSEKRNQLE
RIKTLEEKVRCENIEVDSLKCKVAEMIASGQQGLAASQAQDILNRFDELFEKIKSLLAER
EEQYKDHRLYKEAHDDLIGWLSRAREKIPSMKQRSLSDKLAIENAVVPLESLLNKKAQGE
LLVEHLQHTGKVVCASTSPAGQEVIRNEIRALTESFEGLFKEIQQQKNQLEATVSQWRDY
KDEYERLSDWLQQFDILIKAQKNALLPNLKEKEKQVQEVKELLDNLIKGQEQIDKFNKTA
AGLLSSHLDTYVNNQLRHLNSRYQVQVNLAKDVLNKVETNRAQHQEYESNLEKARDWIKN
AKQIIRQGTEAASSSSREELQSRLDKIQELLRKREEGQNLVHLTVNCGEKVMRNTRSDGR
EEINAQLKEIQNDWERLVKKISTTKVQLETSLLQWADYSSSYSQLQQWINDREAKLQQVC
EQKVSKARKGLAGLSSLAIGERKANLRQTNSIVQDIVAFEPMIHSVTTKAEDLQQATPAT
EISIKYETLSKQAQELYAKQKETVEQHQAFIDSGNEFVQWIRAAKERLGKCSEPTGDKES
LASKITQLKVLQSELPEGQKKLEKALEQGNAACQIADAEDKEIIEEEVALLQEEYDNYVL
EEKKNVLEQFQVHLQTLFDWQKELDCLNMKAQMLLETCADTRISNAITQLTTKYNTLLSL
AKEIMRRLELHYQEHQQHNTLYQECQDWIERTRDKLNECKEIPSTLTEVNNKLHTCKAIR
QTLEQGQNKLRYALELKEKVIMNTEQNGAAKIQEDTENLKSEFDKLLADVEDVRQRLSAR
AGMLEELNKIHRLISDWLEEVEGKVQPADVCRNDLSEKRALLEKCKVLQRDIHGHSETVD
RLKTRLSENPSISTSPYESTIDKYESLKKLISEKIRNLEDQVKDHERFQQALNEAGDWVR
RTKVELQQYSDTHGEKERIVERENKINQIISSLPKGDTLISKVIELSDVVIAKTGPEGQD
SIKQDMKQIQADWKSLQAQCHDSQRTLANCILSWSQFTNALDAMKRWIDHFQKKIADEQT
KENKTPEDLERCKRLVEETIKQKPVLEDLNDKCEALLEISACSWARDKTVQLQSAYTSLL
TDAQGLVSKVEKNLADHTEFLKAKKELEDWLRTAHGSVEDCVGVGDVAWAKDKLETLRLV
ATRVTEGQHLLSTLQNAFAKAINVALPEQQDQLRSDMANLRSSWEQLSIDLNTVQAKVKS
VLSRWEDHAEAYGRFARWLEENESVVRGSPDTKGELGEMKTMLERYRHIQEEVRDRKSDL
DHLIAEATELSAWAKNNAPLNETKQLLDRWQALGKLVGEKRKLVENEMHEYSAYHAALQE
TEKWLLQISFQLMAHNSLYITNKEQTLEQIKQHEALLAEIQKYQEVLDELKAKGHGQINR
YVGANPAIKSTIETQLQNVQDSYNSLLNTALQIKNRLAESLTKFQEYENTLESIMKNLDA
YETEMAQGLDVPLDNLTYAEQSLETARILHNKLQGEKARLALAVEACEAAAACVSRPGSP
LDAPPIQVPAREVEVRTRLDDLIDQMQTHLANVTKTVGELEERSRQKNALRAWINQQRAL
CAEWKSRPAKLRSEAAQAELQAMNEVLTNVGERRARALTELSMHEEDNDIEEELNKLEAE
LTDAIAGKQAAQDLIQKYRSQVQDIQAWFDTLSKKVDVIEKGSGLTISQKISNLKNITAE
FESQGPEKLAEIKKLGDQVMDSVSNLDSQQIEEQIKSVERRHADIGKKLQRKAQVLDMTA
QGIEATRREIEENREWIEQRKQQIKMPELLGFESKQAEERLLSLKAMLKEADGKQLIIDT
LEKRVGNMQNELETSEQQQLEADTKALRGEQVELCTLLREEISVASAAADARRKLEADIE
RARNWIRSKGNDLKKLSGYLPLKASKVEQDIAQHSGLKADINSFNESNLKDILKQGNNLL
KDCNAEGRAKLQALLDDLVKDYEELKKEAKEKQASLADLLQGRKAFENELDKCQRWIKEA
EVATSTELRPSNLDILREQLAKYDRLKKEAQEYGDDIEKINQQGKSILPTISDADKQELS
EQLRNMKEAHGRVAGVINERAVALQKNIDEAEEAAARVAEAIQFMTDIQKELHDLNKPIG
ARVEDVEGMLSAYERILDDLKANKAKLSDLQSANVGNLHGVLAQQDDLIRALEAQIAKLR
QLLLLRQQFIALIAEITTFIAKYTEIIRDIEKSGQTTEEKIKRYDDAILKIQECEATLAS
ATDKGQQIAAEGSVVDRNNITEQLQSLKQQLQALRRAVEMQREQHELAAAEHRRLASELA
EILNWLESKEKEVKSRPLLERDPTSVEAELKKHHELCAGVNEHLDRIKDLKESVRHEEGM
PGSLKEMLSEAVSLLTSLPREMEERGNYLESNMQMRLDYAALTDKLHNWAREAEIRLESN
KEGLDFENILSDLEEHKIYFSTEPSIRELVSQQIQQAADKIWPSLDSYEQEELSAQQQQH
TQLLKNTLNTAKSQRSRLEQGAEMWRDYTQSLERVRAVISRTRFTDEPVTTLAGLQFNIQ
KITHALNDIQNQQFELDLLNDRGREVLRLADANNKKTIESQLSEISSEWRELVSGLEGRR
DALEALSQHWEDLEAQWAIVETRLTTIEEKNKLVDTVVRSKQHLHDVIKALEESVTEAEK
LKPVTEEIKSLAGPVLSYLAVFTEAPARSLKERLEKLQKSAESLVGSLRGKSEKASEDLE
TLENVEREIERLRKRLSEARESATCFYVYGVDQDATEAELGELRSQVEDLVDTAKKFSGS
IKARYQASQQLVPSDITQHLTALELCAEATAQAMEEKQREQKRARTTRSDYLADVDEVQA
WIRQAELKVQDRSVEPAVLREHLRQIQNELGTISDKLERLTKNGQTIVKNTRDDAEKELI
NSTIANLTEQLAQVRSWLEEKRQIVGDTLDAWQRFLTLYEAVKAWTAEKRQFLVEPLKLS
TLAQARQRLHEYSTAVKSCKQVNKNLSDMGRELENIGQVTSVGNLPEKLAEAEEGKVQVE
GQLLERNALLQEASEEWEQCERKMKDVRGWMEKARQTLESPQNKKKPLRDQHAIREKMLS
DIAIQKTKITISVEKLEVHFRSGIGGDNRVKDTADDLIAELSALHSTVKEQASSLEVCLA
QIDQYQQEIQQLRQHIVQVEQQLRTVLSPTYMPNDREKALQEQQICREKIKSLQSKIQAR
AERSKLLVQRGTPDLEPLDPSQ
Download sequence
Identical sequences LH21009-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]