SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LH23956-PA from Linepithema humile v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LH23956-PA
Domain Number 1 Region: 471-569
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-31
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 715-764
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000181
Family TBP-associated factors, TAFs 0.0031
Further Details:      
 
Weak hits

Sequence:  LH23956-PA
Domain Number - Region: 796-903
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0162
Family Troponin T 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LH23956-PA
Sequence length 926
Comment snap_masked-scf7180001005069-abinit-gene-9.33-mRNA-1 protein AED:0.068780247603202 QI:0|0.66|0.4|0.9|1|1|10|0|926
Sequence
MASAKFLEEALSTDVDESAVNAIVGSLETQLVTSTPTVAGHQASSASVSQQNHQVNSAIS
NGGTIAAVQPQKHGVSNGGGATTVNSLMTQEVTKSITTSTLLPVNVVTSNTVAPQVITTQ
QQQPQQQQQQHTQPSGIPAAAYINQVTTNQVSSNQTTHIPSLTKTHEPVKLIYPGQVIAT
TGVANANNKLTFPTQTVGQLANGALGITTQTVLQTTSNVVSNVGPVSQAGSQTVTAVNKP
TGAALVIKTSVAPGGMVSVPMSVPVSVAGNAVSTALQAKAGVTSTIVPSNVQILNVNTMR
PATPVTGQQGNKQITSRVVIGQHQLVGTRSGTPAITLQALQGLQPGTQGHLLLKTENGQY
QLLRVGPAPTAGTATGTAVTPNSIAGNAVVAAPSPGTTYRLTSVPAVSRLNTQFTGPPLA
TLRKSVQTVAPTITTSTATPGTVTTAPTTTSAPTATTVQTVQTSAQRQTTDNTKEKCRKF
LANLLELSSREPKVVELKVRTLIQELIDTKVEPEEFCDRLEKLLNASPQPCLIGFLKKSL
PLLRQSLVTGELVIQGIKPPPANVVFSISAPVVPTITQNTYNTYVRPVTTVVRSPTTAYT
VKSTVAVTGIRPTAPVVQKPPIVTTTVVKTVPTTTQAKTVNTTTTVNKAVVPSLVQKPAA
KEKEKKTFSSAGYTADDDINDVAAMGGVNLAEESQRILGSTEFVGTQIRSCKDEVFLHMT
PLQQRIKQIASRHELEEPNQEVAALISHAVQERLKNLVEKLAVIAEHRIDFIKVDPRYEV
THDVRAQLKFLEDLDRAERKRHEEQERELLLRAAKSRAKTEDPEQAKLKAKAKEMQRAEM
EELRQREANVTALQAIGPRKKPRLDTAGSANSPGSTPGANASASGFNRQMPMRPRLKRVN
FRDLLFLLEQEKETCRSTTLYKSYLK
Download sequence
Identical sequences LH23956-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]