SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CADANGAP00007494 from Aspergillus niger 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CADANGAP00007494
Domain Number 1 Region: 68-387
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.43e-57
Family beta-Lactamase/D-ala carboxypeptidase 0.00000029
Further Details:      
 
Domain Number 2 Region: 496-595
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 3.14e-45
Family D-aminopeptidase, middle and C-terminal domains 0.0000931
Further Details:      
 
Domain Number 3 Region: 418-490
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00000863
Family D-aminopeptidase, middle and C-terminal domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CADANGAP00007494
Sequence length 597
Comment pep:known chromosome:CADRE:I:3175661:3177505:1 gene:CADANGAG00007631 transcript:CADANGAT00007631 description:"Catalytic activity\x3a release of an N-terminal D-Amino acid from a Peptide"
Sequence
MPVWVKGAVRPEPAVSRTGARLPSGSSLKKQALDLNEYLYGYCFFSPSCTEIIFTLNLAF
QVTFPNMQAILEAVPSRYRGPGGAVAIIKDGELAGKLTWGYADLRKRISMTSSTLMPICS
ITKQMLCLILKDLERNPTPAMVERGNIPQQLSDAFRQLVSPELIDSNGLRIDHLCNNQSG
IRDYWAMSMFWGTQPEGEFSLAGDAKKALDRTKSLHFQPGTQFSYCNLNFHILARIVEQV
SGASLGKLLSERLFLPAGMKTAFLCADNAELPAPCVGYEGNESFGYIPAVNRTQWSGDAG
VVASLEDMIAYECYLDQAWADRGSVYREIAKEPSFDDGTPAAYGYGLEHIMFGQTTTIGH
GGAIRGYRLHRTQVPSERLAVVVMLNHEIDAAEVAGHILQEAHSLPAQHGLLSMPVANWV
GFYFDPDAQLVVEVRLGGPGEVILTYTGDEETLKLTERCEARSDLATATLCSDTLLLHRK
YDNRHIQAKRITAGQQPTKGDYVGQYHCAEVDSIFQCSGDGGMLYGSFKGFLGHGPAELM
RYLGDDIWFLACARGLDAPAPGNWTVVFQRDVQGEVVGVTFGCWLARKVTFVKDRTP
Download sequence
Identical sequences A2QT63
5061.CADANGAP00007494 CADANGAP00007494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]