SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CADANGAP00006294 from Aspergillus niger 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CADANGAP00006294
Domain Number 1 Region: 23-109,187-421
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.19e-75
Family IF2B-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CADANGAP00006294
Sequence length 428
Comment pep:known chromosome:CADRE:VIII:1784488:1785995:-1 gene:CADANGAG00006417 transcript:CADANGAT00006417 description:"Putative uncharacterized protein An08g00980"
Sequence
MPSTSAALTPGLASFLKSLKTNPIDTSIDDLISLLKRRQIRHSRSCATATAYLLRSVISA
TRTSDANKMIERVQHVGRRVMAAQPREMVVGNIVRRVLGLIRDEAEDDREADFTLSEAGS
ESQPQTPRALDGSDRSSSRQPFTSLSATPISMFSLLSHPEPESSLPGTPASASPSGRLLG
QSHNKDIRAEVLDGINEIIDELGQVDDQIAAYALEHIHSNEIILTHTSSTTVQKFLLKAA
AKRKFTVIHAESYPNNHEATHATVSGQAPKDDDILSTEAFQKPLIALGITVILIPDSAVF
ALMSRVNKVILGTHSVLANGGLVAAAGTRVIARAAKVHQTPVVVVSGVYKLSPVYPFDFD
SLIEYGDVSKVIGYEDGDLVDQIDVQNPLYDYVPAELVDLYITNLGGHAPSYLYRIVSDH
YRKEDINV
Download sequence
Identical sequences A0A146FVK5 A2QQ20
5061.CADANGAP00006294 CADANGAP00006294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]