SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CADANGAP00011334 from Aspergillus niger 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CADANGAP00011334
Domain Number 1 Region: 273-587
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.3e-71
Family IF2B-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CADANGAP00011334
Sequence length 707
Comment pep:known chromosome:CADRE:I:278481:280811:-1 gene:CADANGAG00011556 transcript:CADANGAT00011556 description:"Putative uncharacterized protein An14g06190"
Sequence
MLGSTVVQYLGVLVVVTAAYVKQQQQSVSQRRERVSSPAPPTTSTSSSTSSSAEKVSNAP
PDRLDSPPPSSYYTFPLIMATPVDSSQPPAEMQSQQSSSSPGAAAAAAGANASAKPAKPQ
QSQPAKQQSQQQQSQSKGKDTAAAGGDGAALSPAELKKKAKAEKAARRARERAEREQSGG
GAAAPGGGQSAAGGKKGASGPGGAGAGGKDASGAATPQKGGHQKQLPRRGSAQATGQLGA
AELKKKQEEKNVSVFGHLYGQQRRTTIAGAGKEVHPAVLALGMQMRDYVVCGSSARCVAT
LLAFKRVCLYSTDMLWGSGCVNVCQVIEAYTTPLGTSLARHLTTHLSHQITYLSTCRPLS
ISQGNAIRALKLAISSIDPSVPEATAKASLCDFIDSFIREKITVADQVIAGSAAQKIQDG
DVIVTFAGSSIVKQTLLAAHKEGKQFRVSIIDSRPLFEGKNLARTLANAGLDVQYSLMNG
ISHAIKDATKVFLGAHAMTSNGRLYSRVGTALVAMSAKERAGGVEVPVIVCCETVKFTDR
VALDSIVVNEIADADELVTVEPVQQDWKESANLQLLNIMYDVTPADTYSASDEYEYQHGF
SGDWMYSVAGESGDFTPDFHSVNSSQQLQHQHSSQTQQPTTNTSRLNSVHNNNTQPYTKH
TTTHYLTSTPTLIRVLHSKWYLPSIPSPSHPLTTTTTTSSSSSPILT
Download sequence
Identical sequences A2R412
5061.CADANGAP00011334 CADANGAP00011334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]