SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478462328|ref|YP_007738149.1| from Chlamydia trachomatis L1/224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478462328|ref|YP_007738149.1|
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily TrpR-like 7.06e-26
Family Trp repressor, TrpR 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478462328|ref|YP_007738149.1|
Sequence length 94
Comment Trp operon repressor [Chlamydia trachomatis L1/224]
Sequence
MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFGERKDVASRYHIIRALLEGELTQRE
IAEKYGVSIAQITRGSNALKGSDPQFKEFLQKEI
Download sequence
Identical sequences B0B9S0 B0BBF0 Q8KQD4
gi|478454195|ref|YP_007716574.1| gi|527319861|ref|YP_008346061.1| gi|527327537|ref|YP_008353728.1| gi|478449689|ref|YP_007719246.1| WP_009873611.1.100883 WP_009873611.1.101735 WP_009873611.1.11148 WP_009873611.1.11732 WP_009873611.1.17082 WP_009873611.1.18643 WP_009873611.1.25195 WP_009873611.1.27753 WP_009873611.1.27980 WP_009873611.1.38181 WP_009873611.1.38794 WP_009873611.1.40464 WP_009873611.1.40808 WP_009873611.1.42718 WP_009873611.1.45552 WP_009873611.1.48923 WP_009873611.1.49465 WP_009873611.1.51159 WP_009873611.1.53299 WP_009873611.1.5416 WP_009873611.1.58046 WP_009873611.1.58308 WP_009873611.1.5967 WP_009873611.1.60427 WP_009873611.1.61004 WP_009873611.1.62489 WP_009873611.1.64162 WP_009873611.1.71307 WP_009873611.1.79775 WP_009873611.1.83642 WP_009873611.1.85365 WP_009873611.1.87079 WP_009873611.1.97423 WP_009873611.1.99598 YP_001654498.1.27483 gi|478466824|ref|YP_007718356.1| gi|339625824|ref|YP_004717303.1| gi|527317980|ref|YP_008344182.1| gi|478467725|ref|YP_007742598.1| gi|482546469|ref|YP_007852385.1| gi|478464125|ref|YP_007740817.1| gi|478451489|ref|YP_007714795.1| gi|478469534|ref|YP_007722814.1| gi|478453303|ref|YP_007717465.1| gi|478465025|ref|YP_007741707.1| gi|482545527|ref|YP_007851445.1| gi|527323628|ref|YP_008349824.1| 471472.CTL0422 471473.CTLon_0416 gi|478470433|ref|YP_007729074.1| gi|478447889|ref|YP_007721923.1| gi|478463227|ref|YP_007739039.1| gi|478450590|ref|YP_007721032.1| gi|478446997|ref|YP_007715685.1| gi|527328463|ref|YP_008354653.1| gi|527325687|ref|YP_008351880.1| gi|478462328|ref|YP_007738149.1| gi|166155255|ref|YP_001653510.1| gi|478452389|ref|YP_007720137.1| gi|166154380|ref|YP_001654498.1| gi|478471324|ref|YP_007739927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]