SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478462408|ref|YP_007738229.1| from Chlamydia trachomatis L1/224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478462408|ref|YP_007738229.1|
Domain Number 1 Region: 104-315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-30
Family Extended AAA-ATPase domain 0.0000573
Further Details:      
 
Domain Number 2 Region: 339-432
Classification Level Classification E-value
Superfamily TrpR-like 5.75e-25
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478462408|ref|YP_007738229.1|
Sequence length 456
Comment chromosomal replication initiation protein [Chlamydia trachomatis L1/224]
Sequence
MRAWEEFLLLQEKEIGVDTVNKWLRSLKVLCFDACNLYLEAKDSFQVTWFEEHIRHKVKA
SLINNNGKPIRVRVTSLDKSTPFKDTQIQQEKTAYFTMKYGDIDPNMSFANFLVTPENDL
PVRILQEFAKVSEQGKGFPFNPIYLFGPESSGKTHLMQAAVGGLREAGVKTLYVTSELFT
EHLVSAIRSGEMQRFRAFYRNVEALFIEDIEVLSGKGATQEEFFHTFNSLHTEGKLIVIS
STFAPGDLKAMEERLISRFEWGISIPVSPLTREGLKSFLERRIEKLNIRIEETALDFLIQ
ALSSHVKSLLHALTTLAKRVAYKKLSHQMLYQGDIEALLHDVLQAAESIRLTPSGIVRAT
AQYYGVSPESVLGRSQSREYVLPRQVAMFLCRQKLSLSYVKIGEVFSRDHSTVISSIRAI
SQKLEEDDRECDVSCAIQELTKRLSSAYQSLDFIED
Download sequence
Identical sequences A0A0E9FWM3 A0A0H3MD98
gi|527326692|ref|YP_008352884.1| gi|527321809|ref|YP_008348007.1| gi|166154461|ref|YP_001654579.1| gi|478452470|ref|YP_007720218.1| gi|478463307|ref|YP_007739119.1| gi|478465105|ref|YP_007741787.1| gi|478470513|ref|YP_007729154.1| gi|166155336|ref|YP_001653591.1| gi|478464205|ref|YP_007740897.1| gi|478449769|ref|YP_007719326.1| gi|482546552|ref|YP_007852468.1| gi|527325770|ref|YP_008351963.1| gi|478469614|ref|YP_007722894.1| gi|527327620|ref|YP_008353811.1| gi|478467805|ref|YP_007742678.1| gi|527318062|ref|YP_008344264.1| gi|478453383|ref|YP_007717545.1| gi|478466904|ref|YP_007718436.1| gi|478450670|ref|YP_007721112.1| gi|482545609|ref|YP_007851527.1| gi|478454275|ref|YP_007716654.1| gi|478462408|ref|YP_007738229.1| gi|478451570|ref|YP_007714876.1| gi|339625909|ref|YP_004717388.1| WP_009873672.1.100883 WP_009873672.1.101735 WP_009873672.1.11148 WP_009873672.1.11732 WP_009873672.1.17082 WP_009873672.1.18643 WP_009873672.1.22210 WP_009873672.1.25195 WP_009873672.1.27753 WP_009873672.1.27980 WP_009873672.1.32801 WP_009873672.1.38181 WP_009873672.1.38794 WP_009873672.1.40464 WP_009873672.1.40808 WP_009873672.1.42718 WP_009873672.1.45552 WP_009873672.1.48923 WP_009873672.1.49465 WP_009873672.1.51159 WP_009873672.1.53299 WP_009873672.1.5416 WP_009873672.1.58046 WP_009873672.1.58308 WP_009873672.1.5967 WP_009873672.1.60427 WP_009873672.1.62489 WP_009873672.1.64162 WP_009873672.1.71307 WP_009873672.1.79775 WP_009873672.1.83642 WP_009873672.1.85365 WP_009873672.1.97423 WP_009873672.1.99598 YP_001654579.1.27483 gi|478447077|ref|YP_007715765.1| gi|478471404|ref|YP_007740007.1| gi|527323711|ref|YP_008349907.1| gi|478447969|ref|YP_007722003.1| 471472.CTL0501 471473.CTLon_0498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]