SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478462873|ref|YP_007738694.1| from Chlamydia trachomatis L1/224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478462873|ref|YP_007738694.1|
Domain Number 1 Region: 167-399
Classification Level Classification E-value
Superfamily TPR-like 8.34e-16
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Weak hits

Sequence:  gi|478462873|ref|YP_007738694.1|
Domain Number - Region: 69-143
Classification Level Classification E-value
Superfamily TPR-like 0.00443
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478462873|ref|YP_007738694.1|
Sequence length 441
Comment putative O-linked N-acetylglucosamine transferase, SPINDLY family [Chlamydia trachomatis L1/224]
Sequence
MWLIVAWTLLACLAMALVFKAYRHVISFRSYVNQVMRDVRLSVDLKEWAVAEMRLAPILK
KRQYRRKYLFEYIRILRELERFEEAEKLLGEAKKLKLAGAHFFLEVAHKAFRHGAYKEAA
HAFSLLSAELMGEREVARYTISLVYLGEVDAACRIIEPWIGPLAHQEVFISVGHIYFATK
RYADAIDFYRRARSLGSCPIDVLYNLAHSLRICGQYVDAGMLFRELLGDPVYKDEAMFNI
GLCEQKLGNSKKALLIYQNSELWVRGDALMMRYAALAAADQQDYQLAEHCWTLAFRCQSY
ADDWNCCVHYGLALCHLKKYAEAEKVYLRVIQKTPDCLVACKALAWLAGVGHATMISARE
GIAYAKRALQIKRSPEVLELLSACEAREGNFDVAYDIQAILAERDTTAKERERRSQILKN
LRQKLPIDQQHIVEVSLLLAA
Download sequence
Identical sequences A0A0E9ATF7 A0A0H3MG73
gi|527329024|ref|YP_008355214.1| gi|527322290|ref|YP_008348488.1| gi|527320420|ref|YP_008346620.1| gi|478470077|ref|YP_007723357.1| gi|166154917|ref|YP_001653172.1| gi|478470977|ref|YP_007729618.1| gi|478450233|ref|YP_007719790.1| gi|166154042|ref|YP_001654160.1| gi|478448435|ref|YP_007722469.1| gi|527323236|ref|YP_008349433.1| gi|478463771|ref|YP_007739583.1| gi|527324192|ref|YP_008350388.1| gi|478454739|ref|YP_007717118.1| gi|478465569|ref|YP_007742251.1| gi|527328098|ref|YP_008354289.1| gi|527326251|ref|YP_008352444.1| gi|478452934|ref|YP_007720682.1| gi|478471868|ref|YP_007740471.1| gi|478462873|ref|YP_007738694.1| gi|482546100|ref|YP_007852016.1| gi|527318542|ref|YP_008344744.1| gi|478464669|ref|YP_007741361.1| gi|478447542|ref|YP_007716230.1| gi|478453847|ref|YP_007718009.1| gi|478468268|ref|YP_007743141.1| gi|478467368|ref|YP_007718900.1| gi|482545158|ref|YP_007851076.1| gi|478452034|ref|YP_007715340.1| gi|527327173|ref|YP_008353365.1| 471472.CTL0069 471473.CTLon_0069 WP_009872075.1.100883 WP_009872075.1.101735 WP_009872075.1.11148 WP_009872075.1.11732 WP_009872075.1.14984 WP_009872075.1.17082 WP_009872075.1.18643 WP_009872075.1.20093 WP_009872075.1.22210 WP_009872075.1.25195 WP_009872075.1.27753 WP_009872075.1.27980 WP_009872075.1.32801 WP_009872075.1.38181 WP_009872075.1.38794 WP_009872075.1.40464 WP_009872075.1.42718 WP_009872075.1.45552 WP_009872075.1.48923 WP_009872075.1.49465 WP_009872075.1.51159 WP_009872075.1.52091 WP_009872075.1.53299 WP_009872075.1.5416 WP_009872075.1.58046 WP_009872075.1.58308 WP_009872075.1.5967 WP_009872075.1.60427 WP_009872075.1.61004 WP_009872075.1.62489 WP_009872075.1.64162 WP_009872075.1.71307 WP_009872075.1.72034 WP_009872075.1.79775 WP_009872075.1.83642 WP_009872075.1.85365 WP_009872075.1.87079 WP_009872075.1.97423 WP_009872075.1.99598 YP_001654160.1.27483 gi|478451134|ref|YP_007721576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]