SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478462900|ref|YP_007738721.1| from Chlamydia trachomatis L1/224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478462900|ref|YP_007738721.1|
Domain Number 1 Region: 353-372,447-653
Classification Level Classification E-value
Superfamily HAD-like 1.61e-51
Family Meta-cation ATPase, catalytic domain P 0.0015
Further Details:      
 
Domain Number 2 Region: 156-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.62e-19
Family Calcium ATPase, transduction domain A 0.006
Further Details:      
 
Domain Number 3 Region: 101-153,251-339
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000275
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478462900|ref|YP_007738721.1|
Sequence length 659
Comment zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis L1/224]
Sequence
MSPQLFSSPFSRELLSDFFESGMAEENSPLLSQKNRRLSQNLTLKSAYISLALYLGSLLS
HWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGA
LLLVLFAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQQDGSLQKVLVQNVKIGEIIRV
KSGEVVPLDGKIIHGASSINLMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAE
STIAHIINLVVQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSCNSVVMDKTGT
LTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAIVNYLTEKQVRSLPATQCTTI
PGEGVSGEFNGEQAFVGRVSTALRYVPEEYREQLRERAQQAQERGDTCSIACLGKRVSLF
YFRDVPRHDAANIVSYLKKNGYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKI
QELAKSRQIMMIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGGTVIVGLNALRLLKNT
Download sequence
Identical sequences A0A0E9ART4
gi|478470104|ref|YP_007723384.1| 471473.CTLon_0096 gi|478467395|ref|YP_007718927.1| gi|166154944|ref|YP_001653199.1| gi|478452061|ref|YP_007715367.1| gi|478454766|ref|YP_007717145.1| gi|478450260|ref|YP_007719817.1| gi|478448462|ref|YP_007722496.1| gi|478452961|ref|YP_007720709.1| gi|478464696|ref|YP_007741388.1| gi|478453874|ref|YP_007718036.1| gi|478471004|ref|YP_007729645.1| gi|478463798|ref|YP_007739610.1| gi|478465596|ref|YP_007742278.1| gi|478471895|ref|YP_007740498.1| gi|478451161|ref|YP_007721603.1| gi|478468295|ref|YP_007743168.1| gi|478462900|ref|YP_007738721.1| WP_012263550.1.101735 WP_012263550.1.18643 WP_012263550.1.25195 WP_012263550.1.27753 WP_012263550.1.38794 WP_012263550.1.40464 WP_012263550.1.42718 WP_012263550.1.45552 WP_012263550.1.48923 WP_012263550.1.49465 WP_012263550.1.51159 WP_012263550.1.53299 WP_012263550.1.5416 WP_012263550.1.58308 WP_012263550.1.5967 WP_012263550.1.64162 WP_012263550.1.79775 WP_012263550.1.97423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]