SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_03555 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_03555
Domain Number 1 Region: 86-136
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00023
Further Details:      
 
Domain Number 2 Region: 37-87
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.12e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_03555
Sequence length 146
Comment locus=Si_gnF.scaffold00206[1267498..1268678].pep_1 quality=100.00 tag=gw_corrected
Sequence
VRAEICEGILLFDDRRFTIWDYYFPYYYEVFLXKMSYQLYRNTTLGVTLQETLDELMQFG
QITPQLALKVLLQFDKAINQALATRVKSRLTFKAGKLNTYRFCDNVWTFMLNDVEFREVQ
EVAIVDKVKIVACDGKTLDADGAAKR
Download sequence
Identical sequences SI2.2.0_03555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]