SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_08701 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_08701
Domain Number 1 Region: 346-473
Classification Level Classification E-value
Superfamily Plus3-like 7.19e-45
Family Plus3 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_08701
Sequence length 696
Comment locus=Si_gnF.scaffold01565[674834..679273].pep_2 quality=100.00
Sequence
MPKRKHQALIDSDSGSASESGSDLDNDLLSLAKKKKGKSQDDSQSNEDNGSVKKDVKHES
DMSDSDDNWNNKSGKTKKKKAPSKRSKRKMTKSSSEDSASEKESAKQLSEPEEGEVSDSD
PSGSSSSQEEFNDGYDDKLMGDAEDQARLAQMTEKEREQEIFKRIEQREIMKTRFEIEKK
LRMAKKQELKKQKESKKKEKGIEERQKIDRAPDPKERSKDRKKTIEEKQDKKFHAMSLLK
ARREEKKEREEKEKQRIEQQQQQSKDMEEEELEDDHKGGANKTKLKASDIYSDDSGSSDS
GEEEEAKQTSQRRSSSSDSRDSDSDNDKKSITSNKARPKKPVYISTKEDLNKIRLSRHKM
ERFVHLPFFDRVVQGCFVRIGIGNNNGKPVYRVAEISGVCETGKIYQLGGTRTNKGLKLR
HGAQERVFRLEFVSNQEFTDSEFFKWKETCALQGISTPTFDEVEQKLKDIKEAMVYEFKE
EDIEKIVREKERFKQTPYNYAMKKAQLMRDRDAANCRGDDETASRLNQELSELEERASEL
DKMRTATISSISYINDRNRKKNVEEAEKAIMEELKANKGKKIDDPFTRRSTKPRMVYKPE
DDSEMVATVPVNDKLNPHPAGDSMSAADKENGQESKKKQSTEDLFNAHDFDITIDLEVPI
PSNPVSVLPKPINNIKDTGPRRSLNLEDYKKKRGLI
Download sequence
Identical sequences E9IFT7
SI2.2.0_08701 XP_011155826.1.47049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]