SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_14750 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SI2.2.0_14750
Domain Number - Region: 11-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0968
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_14750
Sequence length 219
Comment locus=Si_gnF.scaffold07837[1487130..1488288].pep_1 quality=92.69
Sequence
FYIRLCGRNSPNDVYGQCIKDNINNVKNTICSQGLPEFNVSPLEPIIIDKIVVYDRDSLK
LIVTDAKVRDFCDLDITFINVHGDKLRFEAGALIKHITVDATYDFDIQLLVSLAHKGLIH
VTTDDLGVKLEVQLKEVTKNNKTQMYISKTKSQIDITKYTFQFDDEKEGLGQLHDILTKT
INDNAKEIINKIKPSLELALSKTFMSVYNKVIYNRFEQL
Download sequence
Identical sequences E9J950
SI2.2.0_14750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]