SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_10610 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_10610
Domain Number 1 Region: 1388-1623
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000015
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number 2 Region: 1608-1794
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000144
Family Tropomyosin 0.0047
Further Details:      
 
Weak hits

Sequence:  SI2.2.0_10610
Domain Number - Region: 424-533
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000392
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number - Region: 684-797
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0144
Family Myosin rod fragments 0.007
Further Details:      
 
Domain Number - Region: 1147-1317
Classification Level Classification E-value
Superfamily Tropomyosin 0.0226
Family Tropomyosin 0.0053
Further Details:      
 
Domain Number - Region: 1065-1178
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_10610
Sequence length 1935
Comment locus=Si_gnF.scaffold07457[125797..139485].pep_1 quality=100.00
Sequence
MDSARSGGAIEEQGSDEDLSPDALVRQNYELRHRLEEETASYKRRLDTYRQAQQHQAALV
SRLQAKASIIDVLQYKQRCSELENQMAETIPCDTIKPTATATVSSTTVLEAAHQTLRDIR
EEQIHDLDTALKKLGEERRKCEELIQLNATIKDQLEESHQTNEALTNDLQKLSNDWDILR
EELAIKEEEWKEEEHAFNEYYISEHNRLLNLWRDVVSVKRLFAEMKSTTERDLSKLRNEI
ISSSNEMTSACNSANFTMKLQATTGQSTPFSQKMEEEQAVAILKTEITALKQQNVANQHE
IRTKDDRIDQLIREIRNLEERCSVSEAAVSQTMRMQEDIEVLESALRDVAHAVIQDAESR
DADVKQTPTHIHLPSSGLIQQRSPKRSTRSSTIPAFAESTISAVRAALQKYQLTIRELQI
KSQTSKDQILSMRKQCDTAEENAHTLNTRVAELISQLDACRSQCAQLDQEKDMLQKSLDT
VKVEKNALDKNKIELNSTMEALKNNYEKLQKTNNKLQKLCDNLEDEKLYLQNELGRISED
ADLKELSLRSEEDRCSKMREEILTLREDLSKTHLAKDMLEQQKLETDGLISQIEKSKGDL
ELELERILLEKSDVQEILIKIEAMCSNHEQDKQRLQEELKKMTDEKNKLASQCIDQQGDL
NSLRKELLQAEQTRLDVESEKVTLNEKIKFLEIEKEKVEMELGQVTRERSDLSNQLSVLA
RKKETLNEELMRLRQRLEQANEMNARINRNLKDLVKDNEEKQVLLETNEKEFQRLQEQLA
SMRTEKEILEGVLFDTQTNLETTHIRKTQLEKEQKEMLIKQESLKGQVTRLTKELENSEK
RAQDTKQSLTQQSGEQIAEFQQIISNMKRQSEDSIKKINDEKEQVRISLEKRLQQSLLQV
EGEKNEEINQLQQRIEELQQHIENLCKQHEEALLRAENDKQQALLIAHHDQQALIEKIDT
IMRELEEEKNTLERVKREAAARADQERNNTNQLRDELNRLKTKLDETKLKASEEKMKLDL
KIEELWKERESTQREVEELQVQLHMTEDKVDGLQNQLHDTIRKLKDADNVNETMRKELVD
VRRQLADTKYEKEKYNSSNKELREHVKQIESERREQGRTLEELYQKIATLEDAKAAMDVE
RTRLQAQVRDMEREALQLQQQLRFTQDELQKCHENNAQAQNEEKELQARLANEIEERERI
QLQLHQVKKQVVDLDNSLEVTRQELGKLRARADEEDERWRAREQELLVRLEDSRCRERKL
EDQKHNLEVCLADATQQLQELKARLGGSEGRVRALDAQLSQLETAKKEVEQKLSSVGSTL
RRIAGIQMDGSVNMPFKLMSPSRRWSPARAQDHGDTSRDIILDVDPEAVRKGVRSLMQQV
AQIERERDDYKTELCSFKKQLKESQENQSNTDVKVNSLLANIRTLQEERKSIEAKLTQTQ
TSYQAQLDAFQQKTEECEQLCEKLTTLELKISAESDEKLQYEDKLEKLKQELNRLETEKR
NLQKEVRHSDSRATEMELHRMSLDGDLQRLQMMLQEKEAHNQKLQDRFDTQSRTMAGLEE
RCASLKSTIEQLKLSLEKASATESELKSEISLLQHNVMEITTSSQSDNEKLKQLQKQLSN
AENDRRILSERLETVQNTLSNLKHTNQSLIDQNSRLQNELANNEVQRSALESQLRLSTWP
PESNATKDEEVLRQLQTAQRERSEMRGKVEALNDKVKLLEADKRNLERQITAGKTSARSK
SYERPEKAHIELLGTSYSIDSLEHENRELRLKVRKLETQLAEKEAELIRVKSTYIHSSHS
LLDTSRDRGGELERIRAAQLQAEKLLEAREQSHRQQVSRLENQIQLLREQLNQEIKRRQL
YVLRSSRAGREMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDSTLTSSASLPPSLAL
PAPPTYRSSTPSQLK
Download sequence
Identical sequences E9J840
SI2.2.0_10610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]