SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SI2.2.0_11537 from Solenopsis invicta v.2.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SI2.2.0_11537
Domain Number 1 Region: 74-156,184-203
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000392
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SI2.2.0_11537
Sequence length 288
Comment locus=Si_gnF.scaffold09348[2834392..2835688].pep_1 quality=100.00
Sequence
EDGAWLYGPEYVFTVHMNLTEIPQCPPHVRACGDAAGYRITSRLHCIPKMKKNILSCSLK
FVDGFEFDMIGKKKDVVNRRRNITDAPIELFFNEKGIANIVTGQPARVYDLNILKTVVEQ
LNPGDSFNNVGDGTFVGVAESTIGRCNVTFDVNHRSGVGAENEEKRFHHDFRLKLVSPKL
HMTSTEILVIDKLTNLNDCSCYADAYFRKYGDMIVDEDLQADLESMISHMEISETSFSSS
TTRKGTTVLNHKIYNIIENTKIILEDIRPASKDLPAIVKPGETKIIAN
Download sequence
Identical sequences E9JAX1
SI2.2.0_11537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]