SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410667083|ref|YP_006919454.1| from Thermacetogenium phaeum DSM 12270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410667083|ref|YP_006919454.1|
Domain Number 1 Region: 853-979
Classification Level Classification E-value
Superfamily PKD domain 0.000000314
Family PKD domain 0.012
Further Details:      
 
Domain Number 2 Region: 1262-1337
Classification Level Classification E-value
Superfamily PKD domain 0.0000184
Family PKD domain 0.0091
Further Details:      
 
Weak hits

Sequence:  gi|410667083|ref|YP_006919454.1|
Domain Number - Region: 947-1072
Classification Level Classification E-value
Superfamily PKD domain 0.00017
Family PKD domain 0.011
Further Details:      
 
Domain Number - Region: 1342-1413
Classification Level Classification E-value
Superfamily PKD domain 0.000667
Family PKD domain 0.02
Further Details:      
 
Domain Number - Region: 299-424
Classification Level Classification E-value
Superfamily PKD domain 0.0017
Family PKD domain 0.0079
Further Details:      
 
Domain Number - Region: 701-795
Classification Level Classification E-value
Superfamily PKD domain 0.00576
Family PKD domain 0.016
Further Details:      
 
Domain Number - Region: 1177-1258
Classification Level Classification E-value
Superfamily PKD domain 0.0169
Family PKD domain 0.012
Further Details:      
 
Domain Number - Region: 485-610
Classification Level Classification E-value
Superfamily PKD domain 0.0263
Family PKD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410667083|ref|YP_006919454.1|
Sequence length 1527
Comment S-layer/PKD domain-containing protein [Thermacetogenium phaeum DSM 12270]
Sequence
MKQKGRRICVLALVLSLLLCGSAYAAAVLFPDIKGHWAEQTIIELAEKGVIKGYPDGTVR
PDATITRGEFIALLARNHKVDTAAAGREPPTFDDIAGHWSEKNIEALVDRGILDPADYGG
GLKPDEPITRIEIIRMLVRAIGKGEEAKQTTDNTGFADDKSIKSSDKGYVNIAIRYDLVK
GYPDNTIRPEGKTTRAEAFTLLVRQDEVLEKIRKKAEKEGEKKPPSGSSGGGSASYPRAQ
VAFELPAAAHTDTSITVTPVLKYAKTLAWSLAKEAADGSAQPLDLAEAVSGSLDKEGGTI
VFKESGSYTLTASATNYDGKTTSCSQHITVYPVVGIAFELPQHTHTDKTVSIEVATTGLG
NLDIVWSATKDGEAVAWDTAIDGDLSNEGGTITFKEKGGYGITATVTDDTGRSFSHSSSI
TVYPVASVDFELPEKAHTDTTIDLITTLSEMDGLSINWGLTRNGEVVAIGDYLEGELTNA
GGAIRFKEKGVYALTATVTDATGREYAATSETTVYPVGVAGFYLPEITHTDKVVTVKASF
ENIDAATAVWTLTRNGAPVTLGDYVEGTLTSNGGSIRFKDKGEYILAAAFTDPAGRTYGY
SLPVTVYPVPSLSFQLPATAHTDSDIKVDTTSAELDGLTVEWLVDNTYGFQDWATYVDGK
LDNDGGTIRFKHAGVYELVARTTDAAGRVFLFENGSKTEVHPVLNIRFSLPEATYPDRTI
DLRTSGNIGVLPVEWSVSKDGIAVPFDACVEGALNAQGGKIRFTQAGQYTLTASMTDALG
RTFSYTDSVAVYPIPEIQLALPQTAYVGEAAAAAVSGSDLKNLAAAWTISASGGDSKPYT
DYASGDLSNLGGSVTFKTKGDYVLTVTMTDELGRAFSQSKAITVYPIPEIQLTLPQVGYA
GETTSVSVSGNDLENLNASWTISKDGGEAKAYTDYAGGSLTNEGGSITFKAKGSYLLTVT
MTDTLGRSFARSEAITIYPIPEIQLNLPQVGYVGEAASVSVSGSELDNLTASWSISKDGG
DSKPYAEYAGGSLSNVGGNIAFKAKGGYVLTVTLTDALGRTFSQSKAVAVYPIPDMQISL
PQLTYSGEALPVTVSGNELAGLNMVWRISIDGGALAPYTQYAAGTLGNSGGEVRISTDKT
ITVKFTAVTNDENGRSFTFASNTAAIKPIAQIPFSIPSSVHVGTSFTVAMGNVSGLEGKS
ITWSLTKNGGAASYTGTLTNGGGGISIGATGTYTLMASVTNDVGRTFTHSENITVTNTAP
NKPTASATVTRTAKDGKLLVNFAVSATDPDGDAVTYEYSGQSADGYYAVGSYTVKVRAKD
TYGLYSDWTTISFTVANSEPNTPVITRTPDGNSVPPGTPVTITASSTDPDGDAITYVWEG
RPAQTSTYPLGKNTVRVKAVDAVGAESPWTAIVFFVADSTNGGGMTLTGPESVILEEGIE
GATIIEYTFTVPPVSGHSGSDYGRVRGYNKNTRQWDQLDYQTTTNGITFSRTLAPGVYTQ
LEFYYYTNHTCMYNKSNITYSVKYYFE
Download sequence
Identical sequences B0TG26 K4LG53
WP_012281375.1.14683 WP_012281375.1.33279 WP_012281375.1.48650 498761.HM1_0578 gi|410667083|ref|YP_006919454.1| gi|167628695|ref|YP_001679194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]