SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73661324|ref|YP_300105.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73661324|ref|YP_300105.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 5.89e-25
Family Ribosomal protein L9 C-domain 0.0000498
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 6.8e-17
Family Ribosomal protein L9 N-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73661324|ref|YP_300105.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MKVIFTQDVKGKGKKGEVKDVPVGYANNFLLKKNMAVEATPGNLRQLEQKNKAAEAERQQ
EIEDAKKLKEQLSEIEVEVSAKTGEGGKLFGSVSTKQITQALQQQHDIKIDKRKMDLPNG
IHALGYTNVPVKLDKEVEGTIRVHTVEQ
Download sequence
Identical sequences A0A2K3Y6E4 Q4A166
WP_011302021.1.18345 WP_011302021.1.18592 WP_011302021.1.26712 WP_011302021.1.27163 WP_011302021.1.28029 WP_011302021.1.31168 WP_011302021.1.37492 WP_011302021.1.45004 WP_011302021.1.59350 WP_011302021.1.68345 WP_011302021.1.74507 WP_011302021.1.74667 WP_011302021.1.8052 WP_011302021.1.91454 gi|73661324|ref|YP_300105.1| 342451.SSP0015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]