SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73661787|ref|YP_300568.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73661787|ref|YP_300568.1|
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.01e-20
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73661787|ref|YP_300568.1|
Sequence length 154
Comment hypothetical protein SSP0478 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MNYIIEELPTLSVIGEKKIYATGQKAQENIFMFWMEFDDSGKKDQLLELGNNQLPGLLGV
CKPHDSGEIHYLIGVTSEHKYDKWRNIELEGGRYLVFDAKGPVPESIKKAMQQINKDILP
KLDYEIRHAPFFELYKEGAIREDDYVTEIWLPIV
Download sequence
Identical sequences A0A2K3YAU9 A0A2K4CGX6 Q49ZZ7
342451.SSP0478 gi|73661787|ref|YP_300568.1| WP_011302436.1.15726 WP_011302436.1.18345 WP_011302436.1.18592 WP_011302436.1.27163 WP_011302436.1.28029 WP_011302436.1.37492 WP_011302436.1.43091 WP_011302436.1.43215 WP_011302436.1.45004 WP_011302436.1.59350 WP_011302436.1.68345 WP_011302436.1.74667 WP_011302436.1.76174 WP_011302436.1.8052 WP_011302436.1.99191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]