SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73662308|ref|YP_301089.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73662308|ref|YP_301089.1|
Domain Number 1 Region: 36-308
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.61e-64
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73662308|ref|YP_301089.1|
Sequence length 333
Comment proline dehydrogenase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MPIVKDFFIGLSNNSFLNKTAKEVGPMFGANKVVAGNTIKYLIDTIERLNNKGITVTVDC
LGEFVVTEGEAIQAKDQILEVMYAIYNHSLAGHMSVKLSQLGSEFDIDLAYRNLREILLK
ANEFDNMHINIDTEKYDSLFDITQVLDRLKGEFKNVGTVIQAYLYKADALIDKYPELRLR
MVKGAYKENEVIAFQTKEEIDENYIRLIKKRLLSAKNVTSIATHDDKIITQIKQFIKDNK
IDKDRYEFQMLYGFRSDLAEQIAGEGNNFCIYVPYGDDWFSYFMRRLAERPQNLNLMFKE
LLKPDILKKVGTIAGIFAGVVATGSILYRVLKK
Download sequence
Identical sequences A0A0G7GK96 A0A2K3XWP6 Q49YJ5
gi|73662308|ref|YP_301089.1| WP_011302851.1.18345 WP_011302851.1.25302 WP_011302851.1.28029 WP_011302851.1.31168 WP_011302851.1.37492 WP_011302851.1.59350 WP_011302851.1.74667 WP_011302851.1.8052 WP_011302851.1.91454 342451.SSP0999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]