SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73662527|ref|YP_301308.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73662527|ref|YP_301308.1|
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Folate-binding domain 1.38e-93
Family Aminomethyltransferase folate-binding domain 0.000000528
Further Details:      
 
Domain Number 2 Region: 273-358
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.76e-23
Family Aminomethyltransferase beta-barrel domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73662527|ref|YP_301308.1|
Sequence length 363
Comment glycine cleavage system aminomethyltransferase T [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MSNELKKTPLYQTFVDSGAKIVEFGGWAMPVQFSSIKEEHNAVRTEMGLFDVSHMGEIII
KGSDASNLVQYLLSNDTDNVTTHKAQYTALCNEQGGIIDDLITYKLEENVYLLVVNAGNT
EKDFEWMYEKAKAFDAEVINVSTEYGQLAIQGPKARDLVQQYVNIDVSEMKPFEFEQNVE
FFGKNVILSQSGYTGEDGFEIYCNADDAPYLWDEILKNDVTPCGLGARDTLRLEAGLPLH
GQDLSETITPYEAGIAFAAKPLIEADFIGKSVLKDQKENGSKRRTVGLEMIDKGIPRTGY
EVYDLDGNQIGEITSGTQSPLTGKSIGLALINRDAFEMGKEVVVQVRKRQVKAKIVKKNQ
ISK
Download sequence
Identical sequences A0A0G7GRS6 A0A2K3Y8B7 Q49XY1
WP_011303027.1.15726 WP_011303027.1.18345 WP_011303027.1.18592 WP_011303027.1.25302 WP_011303027.1.26712 WP_011303027.1.27163 WP_011303027.1.28029 WP_011303027.1.28454 WP_011303027.1.31168 WP_011303027.1.37492 WP_011303027.1.37647 WP_011303027.1.43091 WP_011303027.1.45004 WP_011303027.1.59350 WP_011303027.1.66168 WP_011303027.1.68604 WP_011303027.1.74667 WP_011303027.1.77974 WP_011303027.1.8052 WP_011303027.1.82244 WP_011303027.1.84863 WP_011303027.1.91454 WP_011303027.1.94572 WP_011303027.1.99191 gi|73662527|ref|YP_301308.1| 342451.SSP1218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]