SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73663724|ref|YP_302505.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73663724|ref|YP_302505.1|
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.23e-98
Family Homocysteine S-methyltransferase 0.00000567
Further Details:      
 
Domain Number 2 Region: 317-602
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.61e-64
Family Methylenetetrahydrofolate reductase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73663724|ref|YP_302505.1|
Sequence length 613
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MSQLLDKLKHNILVADGAIGTILYSEGLDTCPEAYNITHPDKVARIHRSYIDAGADIIQT
NTYGANFEKLKPFGLEHKVKDIHYAAVEIAKQAANDDTFILGTVGGFRGIKQEDLELSSI
QYHTEIQIETLIDAGVDGILFETYYDLEELTTIIKATKRKYDIPIIAQITALNTNYLRNG
TEINTALQQVVKSGADIVGLNCHHGPHHMQQSFSHIELPDGAYLSCYPNASLLDIENSQF
KYSDNAAYFGKVAEQLINEGVRLIGGCCGTTPEHIQYIKSSVSDLKPVNQKNVIPIAKYT
GHSEKPTQKQNLTSKVKHRPTIIVELDTPKHLDTDLFFRNIKKLDDAKIDAVTLADNSLA
TVRISNVAAASIIKQQYDIEPLVHITCRDRNLIGLQSHLLGLSLLGINEILTITGDPSKI
GHLPGATNVYDVNSKGLTEIALRFNQGINTDGDALKTQTNFNIAGAFDPNVRKLDGAVRR
LEKKLESGTHYFITQPVYSKEKIKEVYEATKHLDVPLFIGIMPVTSYNNALFLHNEVPGI
KLSEDILEQFEAVKDDKAKTKSLSIELSKALIDTVHEYFNGLYLITPFQKVDYTLELANY
SKSITSTKQEAIL
Download sequence
Identical sequences Q49UL1
WP_011304003.1.74667 gi|73663724|ref|YP_302505.1| 342451.SSP2415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]