SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73661767|ref|YP_300548.1| from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73661767|ref|YP_300548.1|
Domain Number 1 Region: 30-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-33
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73661767|ref|YP_300548.1|
Sequence length 316
Comment nitrate/sulfonate/bicarbinate ABC transporter periplasmic protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
Sequence
MKKLLILSLIFLVLLSACTQSNSQKQSDKKETIKIGYLPITHSANLMMTQQIQQQTKNAN
YNLELVRFNNWPDLMDALNSGKIDGASTLIELAMKSKEKGSNIKAVALGHHEGNVIMGQN
NETISDFHNHEDYSFAIPHRYSTHYLLLEEMRKQLHLDSDTFSYHEMAPAEMPAALSENR
ISGYSVAEPFGALGEKLGKGHTLKHGSDVIPDAYCCALVLREDLINQHHHTAQAFMTDYK
KAGYKMNNKKQSVEVMSKHFKQDKKVLKQSADWTSYGDLTIEKEGYNKITHLVKEHKLFN
TPDYKDFVDPTLYKEG
Download sequence
Identical sequences A0A0E3CW51 A0A0G7HHQ8 A0A2K3YAR0 A0A2K4C462 Q4A015
WP_011302420.1.10325 WP_011302420.1.15358 WP_011302420.1.15726 WP_011302420.1.18345 WP_011302420.1.18592 WP_011302420.1.25302 WP_011302420.1.26712 WP_011302420.1.27163 WP_011302420.1.28029 WP_011302420.1.28454 WP_011302420.1.31168 WP_011302420.1.37492 WP_011302420.1.37647 WP_011302420.1.43091 WP_011302420.1.43215 WP_011302420.1.45004 WP_011302420.1.54785 WP_011302420.1.59350 WP_011302420.1.63267 WP_011302420.1.66168 WP_011302420.1.68345 WP_011302420.1.68604 WP_011302420.1.74507 WP_011302420.1.74667 WP_011302420.1.76174 WP_011302420.1.77974 WP_011302420.1.80224 WP_011302420.1.8052 WP_011302420.1.81985 WP_011302420.1.9070 WP_011302420.1.91454 WP_011302420.1.94572 WP_011302420.1.99191 gi|73661767|ref|YP_300548.1| 342451.SSP0458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]