SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocvi1|105092|e_gw1.70.141.1 from Cochliobolus victoriae FI3 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocvi1|105092|e_gw1.70.141.1
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.73e-44
Family C-terminal domain of adrenodoxin reductase-like 0.0000075
Further Details:      
 
Domain Number 2 Region: 9-138,305-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000518
Family C-terminal domain of adrenodoxin reductase-like 0.00071
Further Details:      
 
Weak hits

Sequence:  jgi|Cocvi1|105092|e_gw1.70.141.1
Domain Number - Region: 341-448
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00224
Family N-terminal domain of adrenodoxin reductase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocvi1|105092|e_gw1.70.141.1
Sequence length 453
Sequence
MNKNQDAVIDMYEQLPVPYGLVRYGVAPDHPEVKNCQDTFEEVARSPRFNYIGNVKVGYD
VQLADMKPHYDAILFSYGATEDRQLGIPGEHLPGVYSARSFVGWYNGLPQFQHLEPNLDA
GEQAVVIGQGNVALDVARILLSPVDALRNTDIADQAIQALSESKVRSVRVVGRRGPIQAA
FTVKEARELMQIPSVAFEPIDRSLYPADIKKLPRVQKRIAEVLLKGSATPAQQATRSWAL
DFMQAPKAMHEVDGHLSSITFTKQQFVPDGDPFDQRTRVVPTKDETKIEASLAFRSVGYK
SAAIPGLSDIGVPFDDKLGIIPNDMHGRVITPSAGPGNLTAGHVSGLYCAGWVKRGPTGV
IASTMQDAFSSADIIAQDWEAGVPFLNDTNGENKGTRLGWEALREAVESKGARPLSWTDW
KKIDDAERENGKAKGKQREKFQSVEEMLSVLDA
Download sequence
Identical sequences W7EKH8
XP_014554387.1.39273 jgi|Cocvi1|105092|e_gw1.70.141.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]